SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000016842 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000016842
Domain Number 1 Region: 245-566
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.15e-81
Family Protein kinases, catalytic subunit 0.0000000979
Further Details:      
 
Domain Number 2 Region: 17-100
Classification Level Classification E-value
Superfamily CAD & PB1 domains 1.7e-25
Family PB1 domain 0.00000556
Further Details:      
 
Domain Number 3 Region: 116-186
Classification Level Classification E-value
Superfamily Cysteine-rich domain 9.12e-20
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000016842   Gene: ENSLACG00000014835   Transcript: ENSLACT00000016961
Sequence length 589
Comment pep:known_by_projection scaffold:LatCha1:JH126697.1:1110220:1151519:-1 gene:ENSLACG00000014835 transcript:ENSLACT00000016961 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPTQRDSTVSHPGENLHQVRMKAYYKGDIMINHFEPSITYEGLCSEVRDMCAFDNDQLFT
MKWIDEEGDPCTVSSQLELEEAFRLYELNKDSELIIHVFPCVPEKPGMPCPGEDKSIYRR
GARRWRKLYCANGHTFQAKRFNRRAYCAICTDRIWGLGRQGYKCINCKLLVHKKCHKLVT
IECGRPSLAQEPEAPTVQPTLRPEHIEPEIPYKSSSHENLDHVGEEKEAMSIRESGKVPS
SLGLQDFDLIRVIGRGSYAKVLLVRLKKTERIYAMKIVKKELVNDDEDIDWVQTEKHVFE
QASNHPFLVGLHSCFQTESRLFFVIEYVNGGDLMFHMQRQRKLPEEHARYVLHPFLLHSV
FLNERGIIYRDLKLDNVLLDSEGHIKLTDYGMCKEGLRPGDTTSTFCGTPNYIAPEILRG
EDYGFSVDWWALGVLMFEMMAGRSPFDIVGSSDNPDQNTEDYLFQVILEKQIRIPRSLSV
KAASVLKGFLNKDPKERLGCHPQTGFADIQGHPFFRNVDWDLMEQKQVVPPFKPNISGEY
GLDNFDSQFTNEPVQLTPDDDDVVKKIDQSEFEGFEYINPLLMSAEECV
Download sequence
Identical sequences H3B4M1
ENSLACP00000016842 ENSLACP00000016842

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]