SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000017000 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000017000
Domain Number 1 Region: 266-394,692-866
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 2.18e-52
Family Diacylglycerol kinase-like 0.014
Further Details:      
 
Domain Number 2 Region: 2-121
Classification Level Classification E-value
Superfamily PH domain-like 3.15e-28
Family Pleckstrin-homology domain (PH domain) 0.0036
Further Details:      
 
Domain Number 3 Region: 1074-1137
Classification Level Classification E-value
Superfamily SAM/Pointed domain 9e-18
Family SAM (sterile alpha motif) domain 0.0067
Further Details:      
 
Domain Number 4 Region: 168-236
Classification Level Classification E-value
Superfamily Cysteine-rich domain 4.93e-16
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000598
Further Details:      
 
Domain Number 5 Region: 104-162
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000105
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000017000   Gene: ENSLACG00000014968   Transcript: ENSLACT00000017120
Sequence length 1138
Comment pep:known_by_projection scaffold:LatCha1:JH126703.1:1140915:1217244:-1 gene:ENSLACG00000014968 transcript:ENSLACT00000017120 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VKEGLLLKQTSSFQRWKRRYFKLRGRTLYYAKDSKSLIFDEVDLSSASVAETSIKNVNNS
FTVITPFRKLILCAENRKEMEEWMTALKSVQKWENYEATQFNMEHFSGMHNWYACSHARP
TFCNVCHEALSGVTSHGLSCEVCKFKAHKRCAIRATNNCKWTTLASIGHDIIEDEDGVAM
PHQWLEGNLPVSAKCAVCDKACGSVRRLQDWRCLWCKAIVHNGCREQFGKKCPLGQCKVS
IIPPTALNSIDSDGFWKPTGPPSCSSPLLVFVNSKSGDNQGVKFLRKFKQLLNPAQVFDL
MNGGPHLGLRLFQKFVTFRILVCGGDGSVGWVLSELDKLGLHKQCQLGVLPLGTGNDLAR
VLGWGGLCDDDAQLLQVLEKLERATTKMLDRWSVLTYEIPKQSPPSITEEENGDSNIPIP
ISHYADSVAFHLAKILESDQHSDVITSAKFLCETVNDVVTEAGKAYERATENKEEAEAMS
RKCAMLKEKLDSLVKTLNEESQAITVPSGAPPSVVVTEQQADSKEEKKESSGNVTNPMYK
IFKPKDQLMLRANSLKKALRQIIEQAEKVVDEQNKQTQVYRTFSSAASMKEFKSNIFSVS
PGKEADALPPPKKNKINKCIVSQSSLKRGHATSCAIRPAKCIGIKDNSNLILFFNLREVG
EGRKCGFFFPTVLRISHTQPNSVKKAKVQFSERCVMNNYFGIGLDAKISLEFNNKRDEHP
KKYSSRTKNIMWYGVLGTKELLQKTCKNLEQRVQLECDGVLISLPSLQGIAVLNIPSYAG
GINFWGGTKEDINFGAPSFDDKKLEVVAVFGSMQMAMSRVINLQHHRIAQCRTVKITILG
DEGVPVQVDGEAWIQPPGIIKIQHKNRAQMLTRDRAFENTLKSWEDKRRGEGYRLVSRPR
LNSQQSMEYLTEEEAMQMQHLVQAAETLINRIHEAAKSHKVVEQELAHAVNASTVALAEA
ASNRSNLPEILSRSAAVDISISVKALHAETQALLNGRQLQLDCSQEDDLHSTLNAVTTEL
QKLSEIHWMAQVINANEEEVSQGSSKGSMKLKMIPKPKKDRDKLQKQKSNCSLPVEKWGT
EEVAAWLESLGLSEYKSIFIRHDIQGPELTLLERRDLKFLGITKVGHMKRILQGIKDI
Download sequence
Identical sequences H3B529
ENSLACP00000017000 ENSLACP00000017000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]