SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000017011 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000017011
Domain Number 1 Region: 26-153
Classification Level Classification E-value
Superfamily Hormone receptor domain 3.14e-28
Family Hormone receptor domain 0.0027
Further Details:      
 
Domain Number 2 Region: 143-428
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000000000623
Family Rhodopsin-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000017011   Gene: ENSLACG00000014981   Transcript: ENSLACT00000017133
Sequence length 508
Comment pep:known_by_projection scaffold:LatCha1:JH126596.1:1140576:1196085:-1 gene:ENSLACG00000014981 transcript:ENSLACT00000017133 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFGTTNEGCHSCFSCVLLAVSLFLQGHAAESLDVTYEGWKRYMDECQKNMSREPPAKVL
VCNRTSDKFSCWPDALPNTTVNLSCPWYLPWYKKVQHGYLFKKCGPDGQWVLGPDGRPWR
DDSQCRRDESELQAQEEFARTYESFIIMYTVGYSLSLAALVLALGILVGFRKLHCMRNYI
HINLFVSFILRAVSILVKDALVNTQYKKKIDYENKVQVWLSGEAMVGCRTAMVLMQYGIA
ANYYWLLVEGIYLHNLLVIAVFSEKSYFNIYLCIGWGAPVLFVVPWVIVKYLYENIECWS
KNENMGFWWIIRSPILFAILINFFIFIRIIQILVSKLRAHQMRYTDYKFRLAKSTLTLIP
LLGIHEVVFVFITEEHAQGTLRCIKLFFELFFNSFQGLLVAILYCFVNKEVQSELLKKWK
RWKLGKDIDEEYKHTYSQMPQAKTGSSSNQDKHRLVSSHNNGTGKSKQAPHADPHDNGKN
GSSATEQITLSEKLHCYEFPQETAESNF
Download sequence
Identical sequences H3B540
XP_005989135.1.90931 XP_014340029.1.90931 XP_014340030.1.90931 XP_014340031.1.90931 XP_014340032.1.90931 XP_014340033.1.90931 ENSLACP00000017011 ENSLACP00000017011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]