SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000017091 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000017091
Domain Number 1 Region: 295-618
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.96e-88
Family p120GAP domain-like 0.0000721
Further Details:      
 
Domain Number 2 Region: 577-713
Classification Level Classification E-value
Superfamily PH domain-like 8.31e-46
Family Pleckstrin-homology domain (PH domain) 0.0014
Further Details:      
 
Domain Number 3 Region: 146-307
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.81e-26
Family Synaptotagmin-like (S variant) 0.037
Further Details:      
 
Domain Number 4 Region: 14-133
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.45e-23
Family Synaptotagmin-like (S variant) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000017091   Gene: ENSLACG00000015061   Transcript: ENSLACT00000017216
Sequence length 838
Comment pep:known_by_projection scaffold:LatCha1:JH126990.1:1164000:1398333:-1 gene:ENSLACG00000015061 transcript:ENSLACT00000017216 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVEEEGLRVFQSVKIKIGEAKNLSPYPGPNKMRDCYCTVNLDQEEVFRTKIVEKSLCPF
YGEDFYCEIPRSFRHLSFYIFDRDVFRRDSIIGKVAVQKEDLQKYHNKDTWFQLQHVDAD
SEVQGKVHLDLRLSEVITDNGANCHKLAARVLECQGLPIVNGQCDPYATVTLLGPSRSEM
KKTKVKKKTNNPQFDEVFYFEVTRPCSYNRKSHFEVEEEDVDKMEIRVDLWNAINLKFGD
EFLGELRIPLKVLGQSNCYGAWYFLQPRDNGSKSVKVDDLGSLRLNIVYTEDHVFPSEYY
NPLRDLLLKSADVEPVSASAAHVLGEVCREKQEAAIPLVRLFLHYGKIVPFLSAIANAEV
NRTQDSNTIFRGNSLTSKCIDETMKLAGMHYLQVTLKPIVDEICDVHKPCEIDPVKLKDG
ESLETNMENLRQYVDRIFNVITKSGVSCPTVMCDIFFSLRESAAKRFQGDQDVRYTAVSS
FIFLRFFAPAILSPNLFQLRPHHPDPQTSRTLTLISKTIQTLGSLAKSKSAVFKESYMAT
FYEYFSEQKYADAVRNFLELISSSGRRDHKSIEQPIVLKEGFMIKRAQGRKRFGMKNFKK
RWFRLSNHEFTYHKNKGEHPLCNISIENILAVEKLEEESFKMKNMFQVIQPERVLYIQAN
NCVEAKDWIDILTKVSQCNKKRLSVYHPSAYLNGHWLCCKATSDNALGCTPCTGRLPANI
QLDVDGDRETERIYSLFNMYLSKLEKMQEACGSKSVYDGPEQEEYSTFIIDDPQETYKTL
KQIMNAVRTLEQEHAQYKRDKFKKTRYGSQEHPIGDKSFQCYIRQQSESSLGQQQKVK
Download sequence
Identical sequences H3B5C0
XP_005998139.1.90931 ENSLACP00000017091 ENSLACP00000017091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]