SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000017779 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000017779
Domain Number 1 Region: 607-746
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.87e-32
Family PLC-like (P variant) 0.072
Further Details:      
 
Domain Number 2 Region: 1474-1604
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.4e-20
Family Synaptotagmin-like (S variant) 0.012
Further Details:      
 
Domain Number 3 Region: 470-530
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000000102
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.003
Further Details:      
 
Domain Number 4 Region: 4-94
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000000000145
Family PLC-like (P variant) 0.00000817
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000017779   Gene: ENSLACG00000015658   Transcript: ENSLACT00000017909
Sequence length 1646
Comment pep:known_by_projection scaffold:LatCha1:JH126673.1:1322040:1463588:1 gene:ENSLACG00000015658 transcript:ENSLACT00000017909 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FCSEINRLDLGLTVEVWNKGLIWDTMVGMVWIPLKSIRQSNEDGPGEWLTLNSQVIMTDN
EICGTEDPTLHKILLDNRFELPLDIPEEEARYWALKLKQLNMREHDDFEYQEEQDRPLQV
PGSQCCNWNYFGWGAEQNNDDPDSPVDDRDSDYRSETSNSIPPPYYTTSQPNASVHQYPM
RHQQQSSRDSNTDSMHSYDLDYSDQRPVSPTGSSRYASSAELSQGSSQLSEEFDPDNESL
QGSDFDEERDGDAYHSCYSSVSYTKDSPPWDQDEPEPPECYSENEDYPKEEEEDDEEEIY
DQDFIEQETLDQEIYDQEEKEYELEEKKPLPEEAAPEEIPLSLEPIPQQEPEKTVEPSYV
GEDESQHSMSRAKTNWLRAFNKVRMQLQEVRGEGVGDLPKPLWFKGGPGGGLYVIDSMPD
LRKKKPIPLVSDLAMSLVQSRKAGITSALATSTLNNEELKNHVYKKTLQALIYPISCTTP
HNFEVWTATTPTYCYECEGLLWGIARQGMRCTECGVKCHEKCQDLLNADCLQRAAEKSSK
HGAEDRTQNIIMVLKDRMKIRERNKPEIFELIQELFGVQKATHVQQMKAVKQSVLDGTSK
WSAKISITVKVVCAQGLQAKDKTGSSDPYVTVQVGKTKKRTKTIYGNLNPIWEENFHFEC
HNSSDRIKVRVWDEDDDIKSRVKQRFKRESDDFLGQTIIEVRTLSGEMDVWYNLDKRTDK
SAVSGAIRLHISVEIKGEEKVAPYHVQYTCLHENLFHFLTDIQNNGVVKIPDAKGDDAWK
VYFDETAQEIVDEFAMRYGVESIYQAMTHFACLSSKYMCPGVPAVMSTLLANINAYYAHT
TASTNVSASDRFAASNFGKERFVKLLDQLHNSLRIDLSMYRNNFPASSPERLQDLKSTVD
LLTSITFFRMKVQELQSPPRASQVVKDCVKACLNSTYEYIFNNCHELYSREYQTDPSKKA
DVPPEEQGPSIKNLDFWSKLITLIVSIIEEDKNSYTPCLNQFPQELNVGKISAEVMWNLF
AQDMKYAMEEHEKHRLCKSADYMNLHFKVKWLYNEYVTELPSFKSKVPEYPAWFEPFVIQ
WLDENEEVSRDFLHGALERDKKDGFQQTSEHALFSCSVVDVFSQLNQSFEIIKKLECPDP
QIVGHYMRRFAKTISNVLLQYAEIISKDFASYCSKEKVKMPCILMNNIQQLRVQLEKMFE
AMGGKELDVEASDILKELQIKLNNVLDELSRVFATSFQPHIEECVKQMGDILSQVKGTGS
VPASACSSVAQDADNVLQPIMDLLDSNLTLFAKICEKTVLKRVLKELWKLVMNTMEKTIV
LPPLTDQTVNANIYCKFSEGGEKGRVKLVCHTDGTQLIFNAAKELGQLSKLKDHMVREEA
KSLTPKQCAVVELALDTIKQYFHAGGVGLKKTFLEKSPDLQSLRYALSLYTQATDTLIKT
FVQSQSSQVHGGKGIRFTLNEEIYPEKGSGVDDPVGEVSIHVELFTHPGTGEHKVSVKVV
AANDLKWQTSGIFRPFVEVNMIGPHLSDKKRKFATKSKNNSWAPKYNENFQFTLSNETGP
ESYELQICVKDYCFAREDRTVGIAVMQLRDIVQRGSCACWLPLGRRIHMDETGLTVLRIL
SQRNNDEVAKEFVKLKSDTRSAEEGS
Download sequence
Identical sequences H3B7A8
ENSLACP00000017779 ENSLACP00000017779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]