SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000017818 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000017818
Domain Number 1 Region: 80-403
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.62e-84
Family Protein kinases, catalytic subunit 0.00000252
Further Details:      
 
Domain Number 2 Region: 972-1040
Classification Level Classification E-value
Superfamily G protein-binding domain 1.15e-24
Family RhoA-binding domain 0.0000821
Further Details:      
 
Domain Number 3 Region: 1212-1301,1382-1414
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000017
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 
Domain Number 4 Region: 1322-1380
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000192
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.012
Further Details:      
 
Domain Number 5 Region: 434-540
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000105
Family Myosin rod fragments 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSLACP00000017818
Domain Number - Region: 743-865
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0101
Family Myosin rod fragments 0.0041
Further Details:      
 
Domain Number - Region: 545-648
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0942
Family Myosin rod fragments 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000017818   Gene: ENSLACG00000015694   Transcript: ENSLACT00000017948
Sequence length 1462
Comment pep:known_by_projection scaffold:LatCha1:JH126847.1:1330023:1583794:1 gene:ENSLACG00000015694 transcript:ENSLACT00000017948 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQANMSAGTVETSMGNRLKKLEAMITDPRCAVNIESLLDSLKALVQDLDFPALRKNKNIE
NFLNRYEKVAAQIRELQMKAEDYDVVKVIGRGAFGEVQLVRHRTSQKVYAMKLLSKFEMI
KRSDSAFFWEERDIMAFANSPWVVQLFCAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEK
WAKFYTAEVVLALNAIHSMGFIHRDVKPDNMLLDKYGHLKLADFGTCMKMDETGMVRCDT
AVGTPDYISPEVLKSQGGDGYYGRECDWWSVGVFLFEMLVGDTPFYADSLVGTYSKIMDH
KNSLNFPDDVEISKHAKDLICAFLTDREVRLGRNGVEEIKRHPFFKNDQWTWENMRETAA
PVVPELSSDTDSSNFDDIEDDKGEVETFPVPKAFVGNQLPFIGFTYYREEKLLSDSPWSC
RENEHMPSSKSEDSAESAQLQKKLYKLEEQLNNEMQAKDEVEQKYRSVSSRLEKLMKELD
EEVSSRKNVESSLRQLEREKALLQHKHAEYQRKAENEADKKRSLENDVNSLKDQLEDLKR
RNQNSQISNEKINQLQRQLDETNTLLRSESDTATRLRKNQTEMSKQIQQLDATNRELQDK
NCILENTKMKLEKDYINLQSALESERRDCSHGSEMISDLQGRISGLEEEVRNVKSSLSKA
EMEKRQLQDKLTNLEKEKNNLEIDMTYKLKVLQQSLEQEEAEHKATKARLADKNKIYESI
EGAKSEAMKEMEKKLHEERISKQKVENNLLEVEKQCSMLDCDLKQSQQKIEELLRQKDKL
NEEVKNLTLKIEQETQKRCLTQNDLKVQTQQVNALKMSEKQLKQEINHLLEFRQSLEKQN
NELRKERQDADGQMKELQDQLEAEQYFSTLYKTQVREFKEDCEEKSKLCKDIQQKVQELQ
DERDSLAAQLEITLTKADSEQLARSIAEEQYSDLEKEKIMKELEIKEMMARHKQELAEKD
ATIASLEEANRTLTSDVANLANEKEELNNKLKETHEQIQKMKDEELNIAVIKTQYDKQLL
NERTLKTQAVNKLAEIMNRKDVRGGVSRRGNDTDVRRKEKENRKLQLELRSEREKLTQMM
IKYQKEINEMLAQIADENQLRIELQMTLDSKDSDIEQLRSQLQSIHVGLDTTSIGSGPGD
ADADDGFPVHITQSHTSESMSITYKCSSTSVSVATKPSRTHLVLDSDSDHDSDSEEEPLS
YTQAPSDPDNTESRLEGWLSLPVRNNTKKFGWVRKYVVVSSKKILFYDSEQDKEQSNPYM
VLDIDKLFHVRPVTQTDVYRADAKEIPRIFQILYANEGESKKEQEFPVEPLPIGEKSSYI
CHKGHEFIPTLYHFPTNCEACMKPLWHMFKPPPALECRRCHIKCHKDHMDKKEEIIAPCR
VNYDVSTAKNLLLLANSTEEQQKWVSRLVKKIPKKPPATDPFPRSSPRASMKVQPNQSIR
RPSRQLPPNKPSSGPMLRIILQ
Download sequence
Identical sequences H3B7E7
XP_005995980.1.90931 XP_005995981.1.90931 ENSLACP00000017818 ENSLACP00000017818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]