SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000017819 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000017819
Domain Number 1 Region: 42-366
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-84
Family Protein kinases, catalytic subunit 0.00000252
Further Details:      
 
Domain Number 2 Region: 931-1001
Classification Level Classification E-value
Superfamily G protein-binding domain 1.78e-22
Family RhoA-binding domain 0.0000931
Further Details:      
 
Domain Number 3 Region: 1173-1262,1343-1375
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000154
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 
Domain Number 4 Region: 1283-1341
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000192
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.012
Further Details:      
 
Domain Number 5 Region: 393-499
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000863
Family Myosin rod fragments 0.0014
Further Details:      
 
Weak hits

Sequence:  ENSLACP00000017819
Domain Number - Region: 506-608
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0549
Family Myosin rod fragments 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000017819   Gene: ENSLACG00000015694   Transcript: ENSLACT00000017949
Sequence length 1413
Comment pep:known_by_projection scaffold:LatCha1:JH126847.1:1469448:1575538:1 gene:ENSLACG00000015694 transcript:ENSLACT00000017949 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DSLKALVQDLDFPALRKNKNIENFLNRYEKVAAQIRELQMKAEDYDVVKVIGRGAFGEVQ
LVRHRTSQKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFCAFQDDRYLYM
VMEYMPGGDLVNLMSNYDVPEKWAKFYTAEVVLALNAIHSMGFIHRDVKPDNMLLDKYGH
LKLADFGTCMKMDETGMVRCDTAVGTPDYISPEVLKSQGGDGYYGRECDWWSVGVFLFEM
LVGDTPFYADSLVGTYSKIMDHKNSLNFPDDVEISKHAKDLICAFLTDREVRLGRNGVEE
IKRHPFFKNDQWTWENMRETAAPVVPELSSDTDSSNFDDIEDDKGEVETFPVPKAFVGNQ
LPFIGFTYYREEKLLSDSPWSCRENEHMPSSKSEKSAQLQKKLYKLEEQLNNEMQAKDEV
EQKYRSVSSRLEKLMKELDEEVSSRKNVESSLRQLEREKALLQHKHAEYQRKAENEADKK
RSLENDVNSLKDQLEDLKRRNQNSQISNEKINQLQRQLDETNTLLRSESDTATRLRKNQT
EMSKQIQQLDATNRELQDKNCILENTKMKLEKDYINLQSALESERRDCSHGSEMISDLQG
RISGLEEEVRNVKSSLSKAEMEKRQLQDKLTNLEKEKNNLEIDMTYKLKVLQQSLEQEEA
EHKATKARLADKNKIYESIEGAKSEAMKEMEKKLHEERISKQKVENNLLEVEKQCSMLDC
DLKQSQQKIEELLRQKDKLNEEVKNLTLKIEQETQKRCLTQNDLKVQTQQVNALKMSEKQ
LKQEINHLLEFRQSLEKQNNELRKERQDADGQMKELQDQLEAEQYFSTLYKTQVREFKED
CEEKSKLCKDIQQKVQELQDERDSLAAQLEITLTKADSEQLARSIAEEQYSDLEKEKIMK
ELEIKEMMARHKQELAEKDATIASLEEANRTLTSDVANLANEKEELNNKLKETHEQTEIQ
KMKDEELNIAVIKTQYDKQLLNERTLKTQAVNKLAEIMNRKDVRGGVSRRGNDTDVRRKE
KENRKLQLELRSEREKLTQMMIKYQKEINEMLAQIADENQLRIELQMTLDSKDSDIEQLR
SQLQSIHVGLDTTSIGSGPGDADADDGFPVHITQSHTSESMSITYKCSSTSVSVATKPSR
THLVLDSDSDHDSDSEEEPLSYTQAPSDPDNTESRLEGWLSLPVRNNTKKFGWVRKYVVV
SSKKILFYDSEQDKEQSNPYMVLDIDKLFHVRPVTQTDVYRADAKEIPRIFQILYANEGE
SKKEQEFPVEPLPIGEKSSYICHKGHEFIPTLYHFPTNCEACMKPLWHMFKPPPALECRR
CHIKCHKDHMDKKEEIIAPCRVNYDVSTAKNLLLLANSTEEQQKWVSRLVKKIPKKPPAT
DPFPRSSPRASMKVQPNQSIRRPSRQLPPNKPR
Download sequence
Identical sequences H3B7E8
ENSLACP00000017819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]