SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000017935 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000017935
Domain Number 1 Region: 93-283
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 4.8e-23
Family Adenylation domain of NAD+-dependent DNA ligase 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000017935   Gene: ENSLACG00000015801   Transcript: ENSLACT00000018065
Sequence length 360
Comment pep:known_by_projection scaffold:LatCha1:JH126789.1:1360444:1425104:1 gene:ENSLACG00000015801 transcript:ENSLACT00000018065 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEELSQALSASFSVSQDPNSIAAPHPRLLQYKLRSSAQDQEERRRRLLEFQKSKRLDYVN
HARRLAEGDWDDKLSEEEEDDEEETEDMELELKKKKKLPKHYANQLMLSEWLVDIPADLA
EEWFVVACPMGKRALIVASMGSTTAYTKSGFCVNRFPSLLPGGNRRNSAVGKDYTILDCI
YNEVNRTYYVLDVMCWRGHPVYDCQTEFRFYWLHSKLQEDDQLSVISKLNPFKFVGLQSS
ACVPEAICHVLSMDFPFEVDGLLFYHKQTHYTPGSTPLVGWLKPYMVSDILGMAVPEVPL
TRKPNYANEQIQQIVEQKKTKLGQNIVTPAENGRYELEHLSTPKAGLSDAQREKISRMED
Download sequence
Identical sequences H3B7R4
ENSLACP00000017935 ENSLACP00000017935 XP_005994965.1.90931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]