SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000018423 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSLACP00000018423
Domain Number - Region: 395-429
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0262
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000018423   Gene: ENSLACG00000016225   Transcript: ENSLACT00000018556
Sequence length 445
Comment pep:known_by_projection scaffold:LatCha1:JH126674.1:1493085:1525484:-1 gene:ENSLACG00000016225 transcript:ENSLACT00000018556 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKISESPNGEVTGEEHPPQNGTAVPTVNRIRPPFSILISTILFCGELIAAGVLCGCYNQ
SKDQVWLALTLTFMLVSSVLIQFALIFIHRDLTRDRPLVLFLHLLQLGPLVRCMESLVVY
YRAGRKEEPYVSITRKKQLKKGCEREVEQEVGHSLRKLATHRNAFKRTAVIQAFLGSTPQ
LTLQLYVSVMEETILPERVALMVISLLSVTYGALVCNVLAIQIKYDDYKIQLKFTSYLCI
ILWRSLEIATRVTVLILFCTALKIWILPVVLVNMLTLFFLPWVRFWRSKASFPENIEKNF
SKVGTTVVLSMVIFLYASINMFCYSAVQLNLSDRDLIDKAQNWGRLALYYTVRLLENTGL
ILLWYFFQTDVHENICTPLLVLQLLAAYCLAIFFMLIFYQYCHPCRRLFTHNVADCIRCV
RCYRDKHSEPANRQLVDNTVDHNIV
Download sequence
Identical sequences H3B952
ENSLACP00000018423 XP_005992052.1.90931 ENSLACP00000018423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]