SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000018517 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000018517
Domain Number 1 Region: 329-570,604-679
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 1.09e-53
Family Diacylglycerol kinase-like 0.015
Further Details:      
 
Domain Number 2 Region: 39-152
Classification Level Classification E-value
Superfamily EF-hand 1.37e-21
Family Calmodulin-like 0.018
Further Details:      
 
Domain Number 3 Region: 201-269
Classification Level Classification E-value
Superfamily Cysteine-rich domain 2.84e-16
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.011
Further Details:      
 
Domain Number 4 Region: 132-201
Classification Level Classification E-value
Superfamily Cysteine-rich domain 4.04e-16
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000018517   Gene: ENSLACG00000016302   Transcript: ENSLACT00000018650
Sequence length 697
Comment pep:known_by_projection scaffold:LatCha1:JH126764.1:1519774:1677229:1 gene:ENSLACG00000016302 transcript:ENSLACT00000018650 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPRQGSRSAEKKLSLGLRKSHSSLKVSPQLHPSQMPQVVYLKDIVCYLSLLERGRAEDKL
EFMFRLYDTDGNGLLDSSELDRIINQMVHVAEYLEWDATELRPILKEMMEEIDYDHDGTV
TLEEWIRGGMTTIPLLVLLGMETNVKDDGQHVWRLKHFKKPAYCNFCHNMLMGVRKQGLC
CSFCKYTVHERCVSKDIATCISTYVKSRRNTNVMQHIWVEGNSPTKCDRCRKSIKGYQGI
TGLHCVWCQITLHNKCASHVKPECDGGQLKDHILLPSYICPVVLDRQPNQKKTDSDSLVS
TSPNDSNQSFKFNTTTVDGQGLQISPLPGTHPLLVFVNLKSGGRQGERVLRKFQYLLNPR
QVYSLDRGGPTAGLNIFRDIPDFRLLACGGDGTVGWIFDCIDKANFLRHPPVAILPLGTG
NDLARCLRWGGGYEGGNLMKFLKDVEHSTEVMLDRWSIEVIPNDKEEKGDPVPYSIVNNY
FSIGVDASIAHRFHLMREKHPEKFNSRMKNKLWYFEFGTTETFSATCKKLNECLEAECDG
TVLDLSNTSLEGIAILNIPSMHGGSNLWGETKKRRNYNRMSKKVPEKLHSTAVTDAKELK
FCVQDLSDQLLEVVGLEGAMEMGQIYTGLKSAGKRLAQCSCVTIRTSKLLPMQIDGEPWM
QPPCTIKITHRNQVPMLLGPPQKTSFFFLKKRNRSRD
Download sequence
Identical sequences H3B9E6
ENSLACP00000018517 ENSLACP00000018517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]