SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000019169 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000019169
Domain Number 1 Region: 45-152
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 3.14e-37
Family Frizzled cysteine-rich domain 0.0000828
Further Details:      
 
Domain Number 2 Region: 175-293
Classification Level Classification E-value
Superfamily TIMP-like 0.000000345
Family Tissue inhibitor of metalloproteinases, TIMP 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000019169   Gene: ENSLACG00000016862   Transcript: ENSLACT00000019302
Sequence length 301
Comment pep:novel scaffold:LatCha1:JH126690.1:1778530:1782872:1 gene:ENSLACG00000016862 transcript:ENSLACT00000019302 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVGRFGSSVVRRALSLIMLAVLLQTSLLPWGARALFLDPSSSTRCMPIPQRMALCYDIG
YQDMRLPNLLEHETAAEAIHQSSSWLPLLARECHPDARIFLCSLFAPICFDRFIYPCRSL
CEAVRSSCAPIMACYGFSWPEILNCNKFPADHGLCISSIARQINTNLRTVPQASCTDCEL
EEARSYKEILETFCSSDFVVKIRITKRNVTFATISDFVMGPKLDILKHGPLLKGEVRPGL
QQWLALDATCVRNIMRGTRAGSYLVTGEVRSGKMVVNKAYLWHRKDKNLMQASRKWKQHR
C
Download sequence
Identical sequences H3BB98
ENSLACP00000019169 ENSLACP00000019169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]