SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000019413 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000019413
Domain Number 1 Region: 567-765
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.22e-48
Family BCR-homology GTPase activation domain (BH-domain) 0.00011
Further Details:      
 
Domain Number 2 Region: 98-379
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.46e-40
Family FCH domain 0.013
Further Details:      
 
Domain Number 3 Region: 497-546
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000688
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000019413   Gene: ENSLACG00000017076   Transcript: ENSLACT00000019548
Sequence length 962
Comment pep:known_by_projection scaffold:LatCha1:JH126668.1:1894557:1937668:-1 gene:ENSLACG00000017076 transcript:ENSLACT00000019548 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FVFTELRISSGNENNKRLSEIFRDFDALEISVGNEAVDMFISETKDPASTTVSPETEELP
VKTLSYFLGSWERATPEHPSSPPAVEEADEMLVTSEGGVDSALLYAKQWCKYAKELLNWM
EKRLSLEMDYAKNIIKAAEVAKLSINQQPFMPLQYIYTLAMEHDAKCGNSALQTGDTLQM
QRYIPPLTAKRNEIDKWRKEFKEQWQKEQKKMNDSLSALRKARQQYIQRCEDFEKARQLS
TKAEEDQLGMVGVSPSSSSKQLEKRRRSRDEAQSKALESELLYKNCVHDANTRRHELEKV
KERIISHIRKLIFQGDQVLKEVTMTLFGLQQAQTMSIPASYQNLLENCKPYEVGEKYLIF
IQDLQQKDSRMELFEFEEYIPQGRRWADSQISHPHYYRVNHVPGTPPPKKKSQTDIQSTR
MSKSSDTESTGGSSESHSMDSPSSSPAHPGRKLPKVPSAGTIYSDDLDEKVDESAAAENS
GAQCPFKNISLSKAAQTHKLRRLRGPSKCRECETFIVTKGAECEECYLTCHRKCLETLLI
MCGHKKLQNRVSLFGIDFLQIPRDFPEDVPFIVSRCISEIESRALGVQGIYRVSGAKARV
EKLCQAFENGRDLVELSENSPHDITNVLKHFLKELSEPVVSFQIYDECLAFAKDLPRTTE
EAKEGQGFQAGQLRDLIHRIQEILSKLSPSNYNTLCHVIGHLYRVAERYEENKMSPNNLG
IIFGPTLIRQPSACDPLSMVCLLDSGYKSQIVEFLITYYEMIFGMDDLPASKAQAEDSGS
RDGDRHSLGREQPRSSESALGPVPICLWSSSNEAINDLSPEGVRTPDSTEGLGSVKLGEA
QSSEETEEMAQEGVDAEADGLVCTQTRGHFSRQPIKYPRQGPVKVKPIIPRPSGLPLIAT
TAMEENVESNPIGKESGDGKPQTRSNCSSRSSSPDSSTLRRSSGKQHRHFEITTETAKIV
SK
Download sequence
Identical sequences H3BBZ2
ENSLACP00000019413 ENSLACP00000019413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]