SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000019569 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000019569
Domain Number 1 Region: 90-284
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 1.65e-65
Family AlkB-like 0.0000000498
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000019569   Gene: ENSLACG00000017208   Transcript: ENSLACT00000019707
Sequence length 290
Comment pep:known_by_projection scaffold:LatCha1:JH126568.1:1963740:1977136:1 gene:ENSLACG00000017208 transcript:ENSLACT00000019707 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDKRQRVRVQGSWAGPAKRTVLPHSASRTVGSRSHSTAAGPGWVKKESSVPEKQFVFDA
SSEVQKIACAVQYIPSFCRGNGTYEISTGATGVSRLQLLGNFIEPKEADWMFEQLRLEIP
WKQETHVRQGVSYLEPRLTAWYGDLPYSYSRIRKEPNPHWHPLLSMLKDRIEEVTGYTFN
SLLCNLYRNGKDSVDWHSDNEPSLSVNPVIASLSFGDTRVFEMRKKPAPEKNGDFTYVDR
LKVPLDHGTLLIMEGATQEDWQHRVPKEYHDRGARINLTFRTIFPEPAKR
Download sequence
Identical sequences H3BCE8
ENSLACP00000019569 ENSLACP00000019569

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]