SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000019851 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000019851
Domain Number 1 Region: 714-790,825-914
Classification Level Classification E-value
Superfamily RUN domain-like 2.75e-36
Family RUN domain 0.0021
Further Details:      
 
Domain Number 2 Region: 1074-1250
Classification Level Classification E-value
Superfamily RUN domain-like 2.22e-24
Family RUN domain 0.02
Further Details:      
 
Domain Number 3 Region: 921-1019
Classification Level Classification E-value
Superfamily Lipase/lipooxygenase domain (PLAT/LH2 domain) 7.4e-17
Family Lipoxigenase N-terminal domain 0.075
Further Details:      
 
Weak hits

Sequence:  ENSLACP00000019851
Domain Number - Region: 602-673
Classification Level Classification E-value
Superfamily SAICAR synthase-like 0.0785
Family Inositol polyphosphate kinase (IPK) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000019851   Gene: ENSLACG00000017452   Transcript: ENSLACT00000019989
Sequence length 1257
Comment pep:known_by_projection scaffold:LatCha1:JH126609.1:2107297:2160646:-1 gene:ENSLACG00000017452 transcript:ENSLACT00000019989 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALCQFIQASKARDGVGRFVSSAAEGENFEQSPLRRTFKSKVLAHYPENVEWNPFDQDAVG
MLCMPKGLSFKTQADPREPQFHSFIITREDGSRTFGFALTFYEEVTSKQICSAMQTLYHM
HNAEQYDILHTSTTNGKDCDSSTEDCNETSISKLQRFNSYDIGRDTLYVSKCICLITPMS
LMQACKKVLEQLHQAVTSPQPPPLPLESYIYNILYEVPLPPAGRSLKFSGVYGSIICQRP
STSELPLFDFPLNEVFELLGVENMVQLFTCALLEIQILLYSQHYQRLMTVAESITALMFP
FQWQHVYVPILPASLLHFLDAPVPYLMGLHSNGQDDRSKLELPQEANLCFVDVDNHFIEL
PEDLPQFPNKLEFIQEISEILMAFGIPPEGNLHCSESASKIKSFRTSDVVSDKRNGNLAG
SPLSTYELLKENETIARLQALVKRTGVSLEKLEVREETSTKKDLKVQCDEEELKIHQLNI
QIREVFANRFTQMFADYEVFVIQPSQDKESWFTNREQMQNFDKASFLSDQPEPYLPFLSR
FLETQMFASFIDNKIMCHDEEDKDPILRVFDSRVDKIRMLNVRTPTLRTSMYQKCTTIDE
AEKAIELRLAKIDHTAVHPHLLDMKIGQGKYEPGFFPKLQSDVLSMGPTSNKWAKRSAPA
QWRRKDRQKQHTEHLRLDNDQREKYIQEARSLGSSIRQPKLSNLSPSVIAQTNWKFVEGL
LKECRNKTKRMLVEKMGREAVELGHGEVNITGVEENTLIASLCDLLERIWSHGLQVKQGK
SALWSHLFHYQEAKEKKEITSGGLNTSGIIQDTERRKSDTSSAMMPLKVSLIQDMRHIQN
ISEIKTDVGKARAWVRLSMEKKLLSRHLKQLLSDQDLTKKLYKRYAFLRCDDEKEQFLYH
LLSFNAVDYFCFTNVFTTIMIPYHVLIVPSKKLGGSMFTANPWICISGELGETGVLQIPR
SILEMTFECQNLGKLTTVQIGHDNSGLYAKWLVECVMVRNEITGHAYKFSCGRWLGKGVD
DGSLERILVGELVTPNSETDERQCRTPPMQHSPSMIRRLVTISPNSKPKLNTGQIQESVG
EAINGIVKHFHKPEKERGSLTLLLCGETGLVSALDQVFQHGFKSPRLFKSVFIWDFLEKA
YTYYGSLDHSDLTQGENWQTRARTFCQFVNAINSTPRNIGKDGKFQLLVCLGARITRDHL
LHHWIALLADCPVTAQMYEDTALIKDHTLVNSLIRVLQTLQEFNITLETSIVKGIDI
Download sequence
Identical sequences H3BD80
ENSLACP00000019851 ENSLACP00000019851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]