SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000020024 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000020024
Domain Number 1 Region: 1377-1572,1620-1761
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 2.61e-45
Family Hypoxia-inducible factor HIF ihhibitor (FIH1) 0.036
Further Details:      
 
Weak hits

Sequence:  ENSLACP00000020024
Domain Number - Region: 1020-1053
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00303
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000020024   Gene: ENSLACG00000017604   Transcript: ENSLACT00000020162
Sequence length 1770
Comment pep:known_by_projection scaffold:LatCha1:JH126685.1:2226459:2292048:1 gene:ENSLACG00000017604 transcript:ENSLACT00000020162 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDSASLIGKRLLVLFGDSAAGLEPGSEPEQTFLNREWHRGTVRAVRGLSQVTQELAVYV
DFDGSNLKQRSWVKVYAEDVLAILLENSLIWAPHRTLVLIPGARVPTTTHPALMFRVLVD
KIGLGSVVPVEFLLDKTLSFLPGGSSLQLFQEGNDNQNPVFQEHTALWDMVNAWLSEQKL
QAIFSKGPYSVQGQKVKVYQPEFEDCWSLGLVAQQDPVTRLMEVTMDGRDETQLVDPRLV
HVILVDMAPPCKGGLLMMKNSKGKKKRETIEEKDERRKKPALDSDGDFKVKKAKGENGET
NSSGLEGAESSQSLKTAGDTGTEAGPNPTMTPQFVPQMHPNIRFATYTKENGRTLVVQDQ
PIGADASVSFSPFSSARQQPLMGSSITESLNKDQSTSLEVGTERASGSAALGGFSNTMGP
SPTTVRISDSATSAFTGQQQSGWPLAQGDNQKTSLTSAGFGGLQAQPSQLSLFRDGKSQS
NGIFSQENKPSGFKFGSSAMEQSQKETDPSRNLFFQCMSQNIPPSNYFTAISESLAKEPP
SLNVLKQNTDGQKESGLEAGVTVTPNPPQSDNKQIVQGIVSADKKMPSEAMPTLTPAFAG
NILNTRPPENHENLFLQPPKLCREEPLNTFLAFAEKSDSGSFSSLGSQQTTSTPATVIVH
PQDTSSWSAVKIPAESVSGERKTDLFNVTEPQKTISSSPFSAFATGVQRPTSFGNDKPSS
PVPNFTQQMEMPTLASSPTEERHSFRSEMQDSTPIQTFTDIINKQQSVFPSVNFGSGGFS
QEARPLFEEQSKNFSLNDRSVTSKQDSDSSTNSDFSDMSDSEEPLHAKTGLKGSLEDKFG
PSGKGNPELLLGRGKGKGVGKSRPRANPLKVHQSVLKDMSKVRKLKQSGEPFLQDGSCIN
VAPHLHKCRECRLERYRKVKEQDQDDSTVSCRFFHFRRLAFTRKGILRVEGFLNPQQSDP
EAMGLWIPAVSTAEGLDLETSKYILANVGDQFCQLVMSEKEAMMMVEPHQKVAWKRAVRG
VREMCDVCETTLFNIHWVCRKCGFGVCLDCYRLRKARPRTEMEETQEEDVFSWLKCAKGQ
PHEPENLMPTQIIPGTALYNIGDMVHAARGKWGIKANCPCTSRQMKVLPRPVAPNGISQP
SSLNPSTSVSGNEASSSPSGALVMQHGNDDVGKLESIDDGSGDSRKMGVDDGSSSSSINP
NIASSNLKNSRLSSVETTPSSALHWLADLATQKAKEETKESGSLRSVLTKEARSPFSLDS
FNTMSKLSPSSPNLFNSLLLGPSSSNTKTEGSSLRDLLNSGPGKLPQGTSDSTAPFPPVF
SSASSGGKGKGSLPNFLDHIIASVVETRKTDTTKRTGSSMEVQKEVKETVMGLSVLDPNT
SHSWLCDGRLLCLHDPSNKNNWKIFRECWKQGQPVLVSGVHKKLQRELWKPEAFSLEFGD
QDVDLVNCRNCAIISDVKVRDFWDGFEVISKRLKSEDGQPLVLKLKDWPPGEDFRDMMPT
RFDDLMKNLPLPEYTQRDGRLNLASRLPNYFVRPDLGPKMYNAYGLISADDRKVGTTNLH
LDVSDAVNVMVYVGIPEGDGLQEEEAVFIGNRAEVLKTIEEGDADEMTKRRIHEGKEKPG
ALWHIYAAKDAEKIRELLRKVGEEQGQENPPDHDPIHDQSWYLDQILRKRLYEEYGVQGW
AIVQFLGDAVFIPAGAPHQVHNLYSCIKAAEDFVSPEHVKHCFRLTQEFRHLSNTHSNHE
DKLQVKNIIYHAVKDAVGTLKAHESKLARS
Download sequence
Identical sequences H3BDQ3
XP_005992451.1.90931 ENSLACP00000020024 ENSLACP00000020024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]