SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000020032 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000020032
Domain Number 1 Region: 445-738
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.47e-60
Family Protein kinases, catalytic subunit 0.0000123
Further Details:      
 
Domain Number 2 Region: 214-267
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000227
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000020032   Gene: ENSLACG00000017610   Transcript: ENSLACT00000020170
Sequence length 767
Comment pep:known_by_projection scaffold:LatCha1:JH126574.1:2228859:2269715:1 gene:ENSLACG00000017610 transcript:ENSLACT00000020170 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSQEVPEDLTLDTLLDLTEADVNTTMKRYGVNIEECSRLNAALTCLKNVNETGTFYCNIT
KKVEFFANCSPASPTWPSKALFPPPQTGQSPSSVGHVTLPTGLGISSKHSRSVLSREKKA
SQFSFTIPVNKITFTVPNYYTGSLTVHLSKARILVVSVRSAFPTLRGIFFFLRNLVFMRN
SRSIVNLLRMGALCPISFFLEDTLNVPRGSPQMVRRDIGLSVTHRFATRSWLSQTCQVCH
KNMMLGVKCKHCRLKCHNKCTKEAPACRISFLPIPNIRRTESVPSDINNQVDRPVELQFG
GTLPKALTKKEHPPVITPLDSSSNPSSTTSSTPSSPAPFQSSNPPSATPPPNPSPLSHRD
NRFHFPVEVANYPQQITLPPEIAECNSAVKQIENDGIEEQDAETEEQEGDNKSESEYDAD
EVDELPVTRFPGKGPISRKASQTSVYLQEWDIPFEQVELGELIGKGRWGKVYKGKWHGEV
AIRMLEIDGNNQDHLKLFKKEVMNYRQTRHENVVLFMGACMNPPHLAIITSFCKGRTLYS
FVRDPKISLDINKTRQIAQEIIKGIGYLHARGIVHKDLKSKNVFYDNGKVVITDFGLFGI
SGVVQEGRREYELQLSHGWLCYLAPEIVREMTPGKNEDKLPFTKAADVYAFGTIWYELQA
RDWPFTNQPPEATIWQVGSGEGVKQVLATATLGKEVTEILSACWSYDPRERPTFTQLMDM
LEKLPKLNRRLSHPGHFWKSADVNSSKIAPRFERLGLGILEQNNQKI
Download sequence
Identical sequences H3BDR1
ENSLACP00000020032 ENSLACP00000020032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]