SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000020035 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000020035
Domain Number 1 Region: 73-126
Classification Level Classification E-value
Superfamily Cysteine-rich domain 6.58e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0024
Further Details:      
 
Domain Number 2 Region: 231-314
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000116
Family Ras-binding domain, RBD 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000020035   Gene: ENSLACG00000017612   Transcript: ENSLACT00000020173
Sequence length 366
Comment pep:known_by_projection scaffold:LatCha1:JH126569.1:2229172:2283302:1 gene:ENSLACG00000017612 transcript:ENSLACT00000020173 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSDLELIELRNLDLEDRIDLSVGPQDRERPSRLERTNALRITPGKVPEILNRVRKNWLLS
GEGDPKLTEELGEGHDFSPFTHTSPTWCDLCGEFIWGLYKQSLKCINCKFTCHYRCRVLI
QLDCRVQKNRTTDQSDPTELTIERDTNVDELIDWEKQPLSQSEIEQKVKEYNTQINSNLF
MTLGKDGSYTGFVKVQLKLVRPVSVPANKKPSVYNAKQTSTRSQAVKRRTSFYLPKDTFK
HLHISSKTKASEVIEALLKKFMVVDNPRKFALFERAEKEDQVYLRKLSDEERPLYLRLLA
GPNEKTLSFVLKENETGEVNWDAFSMPELSNFLRILQREEEEHVKQILQKYTRCREKIQE
ALGARS
Download sequence
Identical sequences H3BDR4
ENSLACP00000020035 ENSLACP00000020035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]