SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000020435 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000020435
Domain Number 1 Region: 365-546
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.51e-49
Family BCR-homology GTPase activation domain (BH-domain) 0.0001
Further Details:      
 
Domain Number 2 Region: 285-343
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000493
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0094
Further Details:      
 
Weak hits

Sequence:  ENSLACP00000020435
Domain Number - Region: 31-100
Classification Level Classification E-value
Superfamily Tropomyosin 0.018
Family Tropomyosin 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000020435   Gene: ENSLACG00000017960   Transcript: ENSLACT00000020575
Sequence length 635
Comment pep:known_by_projection scaffold:LatCha1:JH126563.1:2546422:2563097:1 gene:ENSLACG00000017960 transcript:ENSLACT00000020575 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGALVNLRNLFDQLLRQVEVLNDGIEPQFIQLARSFEDCRKKWQRTEQDLGKHKELLMK
AETERSSLDVKLKHARNQVDVEIKRRQRAEADCERLERQIHLIRDLLVCEGSNSIQLSEE
QRTALAFLNNRSQAQNGYTANKRLSTIDESGSILSDISYDKTEDSLDWDSSLVKTVRLKK
REKRRSSRNHTDGPPAPSKRSRSINASADQGNESIVTKTTVTVPGNGGPIEAVATIETVP
YWTRSRRRTVLQSWNADSTSENTVGVPEQRQRSNPTELSGGCSTPQSNGGVRLHEFVSKT
VIKPESCVPCGKRIKFGKLALKCRDCRVVAHPECRDRCPLPCIPTLGGTPVRIGDGCLAD
FVSNSAPMIPSIVVHCVNEIEQRGLSETGLYRISGCDRTVKELKEKFVRGKNVPLLSKVE
DIHAICGLLKDFLRNLKEPLLTFRLNKIFMQAAEISDEDNSIAAIYQAVSELPQPNRDTL
AFLMIHLQRVAQSPHCKMNVSNLSKVFGPTIVAHAVSDPDPMTILQDTKRQPQVVERLLR
LPVEYWSQFMIVDQENINQSHIIENSNAFHTPDFKVSMLGPLTTPEHQLSKTPSSSSLSQ
RVKSTFKTTPKFGSKSKSATSVNRQGNFFASPLLK
Download sequence
Identical sequences H3BEW4
ENSLACP00000020435 ENSLACP00000020435 XP_014351732.1.90931 XP_014351768.1.90931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]