SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000020607 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000020607
Domain Number 1 Region: 22-353
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.02e-78
Family Protein kinases, catalytic subunit 0.00000258
Further Details:      
 
Domain Number 2 Region: 940-998
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000464
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0066
Further Details:      
 
Domain Number 3 Region: 1014-1135
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000334
Family Pleckstrin-homology domain (PH domain) 0.031
Further Details:      
 
Weak hits

Sequence:  ENSLACP00000020607
Domain Number - Region: 1170-1288,1373-1419
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0153
Family WD40-repeat 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000020607   Gene: ENSLACG00000018109   Transcript: ENSLACT00000020747
Sequence length 1528
Comment pep:known_by_projection scaffold:LatCha1:JH126593.1:2741256:2781262:-1 gene:ENSLACG00000018109 transcript:ENSLACT00000020747 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IFAFLFVAKPFVTRVKQMRLHRDDFEILKVIGRGAFGEVAVVKLKNSEKVFAMKILHKWE
MLKRAETACFREERDVLVKGDSQWITTLHFTFQDEQYLYLVMDYYVGGDLLTLLSKFEDR
LPEDMARFYLAEMVLAVHSIHQLSYVHRDIKPDNVLIDMNGHIRLADFGSCLKLREDGMV
ESPVAVGTPDYISPEILQAMEDGKGRYGTECDWWSLGVCMYELLFGETPFYAESLAETYG
KIMNHKDKLQFPSDITDVSDSAKDLISQLICSREQRMGQNGVEDFKEHPFFAGIDWDNIR
NSIPPYIPEVTSPADTSNFDVDDESLKNSETLPPTSHGAFSGHHLPFAGFTYTSNCCLSD
RGSLQEVLSGGPVQQTLSDPSTAVALEGKIKHLEREKLELNRKLQAHAETLQKSSTSTPP
SPGVAGKESEIKSLKEEMEILRDKLAESYLGKQLEEDDVLKRQREQEAGRVQVLEKQQRA
QKQEKEDLYRELVEVQERLKSQSKELREATSRQKLTAQELLVAEEKCLEARSEKKKLWRQ
LQDKEEEMAVVMQKVESLRQDLRKAESESKKLESQMEEVEGEVSKQRKLRERSEQFSKQL
EEELEVLKLKQAGPSGASVGSDHTKELSRLKAELEKRHVQYEEELGKREAAHATELKHLQ
KELQESELRPEALLSEISGMKEKLGKARAESLLEQEEALVEMKEKSEREKNLLMEENRRL
TGELDQLTEQIELMQAVHRQLEQELRSVEEKKDSIANWEVQITDILHWVNEEKDSRVYFQ
ALSNKMAEELESMKSFSSGVKPMENQWKARRLQKMEASAKLELQSALDAEIRAKQAVQEE
LNEMKATNLTTECKLQAAESQNEALKIEIEKLKEELKSRSPAGLKHQDSLIPFVPLRSLE
NNTISFSSPQVSPQENQRPPNLHDYLPDVRALNQGDPLTSFYIPKSHQFKVKTFTFPTKC
LRCMSVMVGLVRQGCVCEACNYVCHVDCSVLPSVCPMPPDKTKRPLGIDPVSGTGTAYEG
YLSIPKPSGVKRGWQRMFAVISDFRLLLYDVLEGKGSQGSVAQVIDMRSETVRESDSVCT
CEISNASRRVWAHCIQRVMASQLFAPSTKCSLLLLAESEKEKNKWVAVITELQRILWQNQ
HGDRSVYIPKEAYDSALPFIRATQSAAIVDHERLALGTEEGLYLLQLTMNEITQVGDCKK
VHQIEVLPRVQMVAVLSGRNRSIRLYTCHHLEEVETSGIKISESKNCQTMATGVICQGTT
TCLCVAMKRQVACFKVTKTKPYYQKMRDIQAQGNVQWMGVAPDRLCVGYPSGFCLYPLLN
EGPPWNLLSPEDPTLAFIAHAQMDALCSVEVARNEHLLCFSHVGVYVNCQGRRSRNQELM
LPAHPVACCYNTPYLIVYSENAVDVFDVTSIQWIQTLPMKKVRPVNSNGSLNTFGTETVR
LIYLRYKFAVSDEFAVPKVTHNSRRQLQRSKSKRKFAFRISDEERLQQRREMLRDPEMRS
KLISNPTNFNHLVHVGPGDKMQHLKDLP
Download sequence
Identical sequences H3BFD6
ENSLACP00000020607 ENSLACP00000020607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]