SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000020825 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000020825
Domain Number 1 Region: 757-1090
Classification Level Classification E-value
Superfamily Cysteine proteinases 4.91e-110
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.000000000015
Further Details:      
 
Domain Number 2 Region: 7-135
Classification Level Classification E-value
Superfamily USP8 N-terminal domain-like 2.48e-46
Family USP8 N-terminal domain-like 0.00000159
Further Details:      
 
Domain Number 3 Region: 181-327
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 8.96e-30
Family Ubiquitin carboxyl-terminal hydrolase 8, USP8 0.00000384
Further Details:      
 
Weak hits

Sequence:  ENSLACP00000020825
Domain Number - Region: 631-666
Classification Level Classification E-value
Superfamily WW domain 0.0133
Family WW domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000020825   Gene: ENSLACG00000018295   Transcript: ENSLACT00000020965
Sequence length 1102
Comment pep:known_by_projection scaffold:LatCha1:JH126608.1:2999589:3062844:1 gene:ENSLACG00000018295 transcript:ENSLACT00000020965 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAVSSVPKELYISTSLKELNRKAEVKPEKISTRSYVQSACKLFKTAEENRLDRDEERAY
VLYMKYLSVYELIKNRTDFKRQQDYYLSLLGPTSFKKAVEEAEKLSESLKLRYEEAEVRK
KLEERERIEEQKKEQEAARNEEKIFTNNSSVDIADSAKENQKVNGDQKIVKPGKESATVA
RAPGSITAEKLYGMVKDQGISIIIMDARSLKDYLESHIQVPEQCCISVPEEAISPGITVN
QIEAKLPNESKVLWMNRGFVDYIVLLDWFSTINELTLGTTLQSLKDALFKWDSQTILRSE
PLVLEGGYENWLLCYPMYTTNAKVVPPKTENTGSVSVLLNFSYPTLEEPAASVQPEISPV
EINEKIESPETMATGDKISGSEMKVLNVQTPTGPLPAGANSVPAPKAGDPSACQPANVMK
VIPQIDRTKKPSLKMQTNKPKPETTVADHPHIQNGRLIPDRSTKPPLDPKNVLTEEEKNR
IHVETALLMEKAKREKEQRERERLEQKQREQEEREQKEKDDAERKEKEQKAREAEKEQRE
KEERERQLELERKRREGIEEERTEAEKAELEEKKNVEKREQTKITGETAEVQKKTVEEES
ASVAVDTSANKENQTQREPLTRARSEEMGRTVPGLPEGWMKFLDIVTGTFRYYHSPTNSV
HMYPPEMAPSVTPPATPPTHKAKQQAQAELDREHSKLKRSYSSPDITRAIQEEGKKKATV
TPTVNRETKPTSYTKTEIARPSASQIRNLNPVFGGLGPGLTGLRNLGNTCYMNSVLQCLS
NTPHLAEYFIRNYYQEDINRANILGHKGEVAEEFGVIMKALWAGQYRYLSPRDFKITIGR
INDQFAGYAQQDSQELLLFLMDGLHEDLNKADNRKRHKEENNDNLNDLKASEQAWSKHKQ
LNESIIVALFQGQFKSTVQCLTCLKKSRTFEAFMYLSLPLASTSKCTLQDCLRLFSKEEK
LTDNNRFYCGHCKTQRDSLKKIEIWKLPPILLVHLKRFSYEGRWKQKLQTSVDFPLENLD
LSQYVIGPKNNLKRYNLYGVSNHYGGLDGGHYTAYCKNVIKQRWNKFDDHEVSEISTSSV
KSSAAYILFYSSLELRAADIAT
Download sequence
Identical sequences H3BG04
ENSLACP00000020825 ENSLACP00000020825 XP_005989697.1.90931 XP_014340307.1.90931 XP_014340308.1.90931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]