SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000020867 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000020867
Domain Number 1 Region: 393-699
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.09e-84
Family Protein kinases, catalytic subunit 0.000000016
Further Details:      
 
Domain Number 2 Region: 6-135
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.83e-27
Family PLC-like (P variant) 0.0000308
Further Details:      
 
Domain Number 3 Region: 234-295
Classification Level Classification E-value
Superfamily Cysteine-rich domain 2.39e-20
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00053
Further Details:      
 
Domain Number 4 Region: 159-221
Classification Level Classification E-value
Superfamily Cysteine-rich domain 2.54e-19
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000020867   Gene: ENSLACG00000018333   Transcript: ENSLACT00000021007
Sequence length 708
Comment pep:known_by_projection scaffold:LatCha1:JH126564.1:3076774:3195650:-1 gene:ENSLACG00000018333 transcript:ENSLACT00000021007 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALKFNGYLKVRIGEAVGLKPTSFSRRHSLFNKTTPPMDPYIAINVDECRIGRTRTKQKT
NSPTYNEEFCVNVSNGKRLELAVFHDTSIGYDSFVANCCIRLEDLLRTPGSEEYFEGWMN
LEPEGKIYIVVTLTGSFTEGLPSENGKQFQNFTRQRQRAMRRRIHQVNGHKFMATFLRQP
TYCSHCKDFIWGVFGKQGYQCQVCTCVVHKRCHQLVVTVCPRIKSTATEKKAVSKKFSIN
LPHKFSVHNYKVPTFCEHCGSLLWGLMRQGLQCKLCKMNVHIRCEGNVAPNCGVKAVELA
KTLAEMGQHAGGFPSELELPLPFPTLSCEIELEQSNLLASLTSSRARMKAHNKGELAPPL
NAPTVPVDSTSKCNKTTFNSIILPPPPKKKKLVMLAQLKDKSDMYAVKVLKKDVILQDDD
VECTMTEKRILSMAGIHPFLTQLFCCFQTRSNLFFVMEFVNGGDLMFHIQKSRKFDEPRA
QFYAAEITSALMFLHEKGIIYRDLKLDNVLLDYEGHCKLADFGMCKEGISKGRTTSTFCG
TPDYIAPEILQEMQYGPSVDWWAFGVLLYEMLCGHAPFEAENEDDLFEAILKEEVTYPPC
LYSNATNFLKALLMKNPEKRLGSMACYDGEQAILNHPFFKEIDWELLNKRQLEPPFKPRI
HSKEDISNFDPEFTKEEPRLTPIDPGLLPMIDQNEFRNFSYTAEALEF
Download sequence
Identical sequences H3BG46
ENSLACP00000020867 ENSLACP00000020867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]