SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000021020 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000021020
Domain Number 1 Region: 56-462
Classification Level Classification E-value
Superfamily Ras GEF 1.02e-101
Family Ras GEF 0.00043
Further Details:      
 
Domain Number 2 Region: 533-592
Classification Level Classification E-value
Superfamily Cysteine-rich domain 2.84e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0018
Further Details:      
 
Domain Number 3 Region: 459-532
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000223
Family Calmodulin-like 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000021020   Gene: ENSLACG00000018469   Transcript: ENSLACT00000021160
Sequence length 692
Comment pep:known_by_projection scaffold:LatCha1:JH126578.1:3373288:3408880:-1 gene:ENSLACG00000018469 transcript:ENSLACT00000021160 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VKTLGLKSRQECAVPVVSSSGGSSSKVRQRQPRRRMTCPSPAEINKAKAMMSMGQVTKSC
SLEELIEKCIQSFDSDGSLYRNSQMVNMTLMMHSWVVPSAEFARKLLNIYPFTVCQHRPA
LLVKICYLVRHWITQYPAVFKLDSKLEEVMADFQETVKREGEESHYNLMDTSNIPTHEWT
RRFTYHGPPNCNKKRKVSLLFDHLDPSELANHLSYLEFKSFCRISYLDLKSYALHGSVRE
NPTLERTVTLCNGVSQWVQLMILNRPTPQQRAEVFSKFIHVAQKLRHLQNFNTLMAVIGA
LCHSSVSRLKETSSFLSQEVTKALNEMTELLSSSSNYSSYRRVYSECIGFKIPILGVHLK
DLVSLHEALPDYLEDNKINLSKLQSLYNHVSELIQLQNNTPPFEANKDLVHLLTLSLDLY
YTEDEIYELSYSREPKSTKALPPTPCKPPVVVDWAPGVAPKVDPDTITKHVQQMVDSVFT
NYDHDQDGYISQEEFERIASSFPFPFYVIDKDRDGMISREEITEYFMRASSNYSKLGLGF
PHNFQETTYKKPTFCYICTGFFWGVTKQGYRCQGCGINCHKHCMDQVSQECKKRFKSFPN
DSFTALYPNLLNPGTPTNSKTTSSGSEDDTFMFPHGDGSEHGDENKDQSITATEGPALKK
LVGCRSAVAHKSTQTEKPYLETSPPRRVLQYP
Download sequence
Identical sequences H3BGJ9
ENSLACP00000021020 ENSLACP00000021020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]