SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000021561 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000021561
Domain Number 1 Region: 505-575
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 6.91e-20
Family Double-stranded RNA-binding domain (dsRBD) 0.00028
Further Details:      
 
Domain Number 2 Region: 383-455
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 7.07e-19
Family Double-stranded RNA-binding domain (dsRBD) 0.0000266
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000021561   Gene: ENSLACG00000018943   Transcript: ENSLACT00000021702
Sequence length 673
Comment pep:known_by_projection scaffold:LatCha1:JH126572.1:5529938:5630439:1 gene:ENSLACG00000018943 transcript:ENSLACT00000021702 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSIRSFANDDRHVMAKHSMIYPSPEELEAVQNMVSTVECALKHVSDWMDEVNKPIKTEV
SEEPKKEDSTETDAKEQSGRTLCGVMRIGLVAKGLLIKDDMDLELVLMCKEKPTETLLYK
VKDNLPVQIQKLTEESYEVQLYVSEAAIIVHSTKEPSLTLKVILTSPLMREENDKKDEVE
NVAMKDPPDLLDRQKCLNALASLRHAKWFQARANGLKSCVIVLRILRDLCNRVPAWKPLK
GWPLELICEKAIGTCNRPLGAGEALRRVMECVASGILLSGGPGLHDPCEKELTDTLAFMS
EQQREDITHHAQHALRLLAFGQIYKVLEMDPLPSNKPQRYSWSVADKEGSGLKRPFEDGV
GDDKDPNKKMKRNLRKILDSKAIDVNQPMNALMRLNQISPGLQYKLLSQSGPVHAPVFTM
SVEVDGTTYEASGPSKKTAKLHVAVKVLQAMGYPTGFDTDVDSMSADEKSDNEGKNETVS
ANSSNNTASSTDNSNTLEVKTQGPILTASGKNPVMELNEKRRGLKYELISETGGSHDKRF
VMEVEVDGQKFRGAGPNKKVAKASAALAALEKLFSGPNAAHIKKKKIVPQTKGSVATTLS
AVAQVARGRGRGALTRGAFIGAAAAPGYITPGYGAPYGYSAAAATPAYGLPKRMLLLPVM
KFPTYPVPHYSFF
Download sequence
Identical sequences H3BI40
XP_005987408.1.90931 XP_014346092.1.90931 XP_014346096.1.90931 ENSLACP00000021561 ENSLACP00000021561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]