SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000021872 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000021872
Domain Number 1 Region: 165-225
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000121
Family Ras-binding domain, RBD 0.03
Further Details:      
 
Weak hits

Sequence:  ENSLACP00000021872
Domain Number - Region: 245-292
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0929
Family Apolipoprotein A-I 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000021872   Gene: ENSLACG00000004230   Transcript: ENSLACT00000025940
Sequence length 299
Comment pep:known_by_projection scaffold:LatCha1:JH128548.1:114032:156150:1 gene:ENSLACG00000004230 transcript:ENSLACT00000025940 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRFIPDPFQQLHCVCSAFLQEDGELVIEGLLNISWGLRRPIRLQMHDANERIHLAGPGSW
RGELANLSRNETGQTVANKSVQETKSNPGESSESMQNESNASREEEETPQLMRTRSDASF
MIQRRSKQHSAGEMQRMRRHRFSINGHFYNHKTSVFTPAYGTVTNVRVNSTMTTPQVLKL
LLNKFRVENSPEEFALYVVHECGERTKLRNDEYPLIARVLHGPCEKIAKLFLMETDLGEE
VTYDVAQYIKFEMPVLDSFVEKLKEEEEREITKLTQKYSALRSTIQQRLGDLTDNEDHL
Download sequence
Identical sequences M3XGL6
ENSLACP00000021872 ENSLACP00000021872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]