SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000021951 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000021951
Domain Number 1 Region: 403-609
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.42e-52
Family BCR-homology GTPase activation domain (BH-domain) 0.0000673
Further Details:      
 
Domain Number 2 Region: 1-153
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 6.28e-20
Family FCH domain 0.074
Further Details:      
 
Domain Number 3 Region: 330-383
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000254
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000021951   Gene: ENSLACG00000006557   Transcript: ENSLACT00000025968
Sequence length 984
Comment pep:known_by_projection scaffold:LatCha1:JH127782.1:315169:343065:1 gene:ENSLACG00000006557 transcript:ENSLACT00000025968 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQEAETAVRKAKLMYIQRQEDYERAKSSTLRAEEENISSSGGVVKDAVKLLEKRRRLEEE
AMQKAEEASEHYKACMADVSEKRTGLENIKSEILAQLRELVYQCDLTLKAATVNLFQLQH
AQVVSLPVNFQSLCESAKLYEPGQQYSEFVKNLPKEDGLAESFSFEAQNAGLPLHKKTSN
SAHSSHGNLSQASGTSGEFPTQSADDVGSLDNCKYEKSGQKRSNSTDIQALRGQGTYKAW
PSGSQGCGMCSDSESAGGSSESRSMDSPSASPVDFKRRIPRTPSTGTMSSADDLDEREPP
SPSDNVLGLAEIASEVTSSPGPFRNAMMSKAAQTHKLRKLRAPSKCRECDSLVVFHGAEC
EECSLACHKKCLETLAIQCGHKKLQGRLHLFGVDFAQAAKNAPDGIPFIIKKCTSEIESR
ALNAKGIYRVNGAKSRVEKLCQVFENGKDLVELSDLYAHDISNVLKLYLRQLPEPLILFR
LYNDFIGLAKESRRIYEEIESKQNCSAAKKRYSWNIELNRIIFKMRDLLKQLPQPNYNTL
QYLLRHLQRITEKEEENKMSASNLGIIFGPTLIRPRQTDAAVSLSSLVDYPYQARVVELF
IVHCEKIFDISFNSLASTPAEGNSPVEVNVRSISLSAEEKDQEQNRKSQPFSGGKEAIQL
SKSEEAATFKEQNEAKGMKQILDSSSVTNYTVDQKSDEIEVPISSPGCEDSEIAHDSCFI
KVQMRPPRAKPVIRPVSLPADRIGNPCFLNEKNSKNLGSSNPGKMSRSPTIEEVLETKTH
STASTYRYSCYDTQFLRRTWDRQYKSYDMTPRTAMIMANVSQENRAHDGGNASGLQSCYN
YGNSSGNAILPNKPYTVSVRPVRAMVTEGITPDSSFSAIFRAPRTLQPPPGTFYKPPSTS
QPKQSEDSLVKTCVTMVNSTVTVHENSEVVSSLTNPESLSNLPRQDLNKNVSSEGLHQIE
AKPPYPRMRPKRMQEIEHREAHFV
Download sequence
Identical sequences M3XGU5
ENSLACP00000021951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]