SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000022105 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000022105
Domain Number 1 Region: 277-405,721-894
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 1.7e-52
Family Diacylglycerol kinase-like 0.022
Further Details:      
 
Domain Number 2 Region: 3-132
Classification Level Classification E-value
Superfamily PH domain-like 1.39e-30
Family Pleckstrin-homology domain (PH domain) 0.0048
Further Details:      
 
Domain Number 3 Region: 1103-1168
Classification Level Classification E-value
Superfamily SAM/Pointed domain 4.43e-19
Family SAM (sterile alpha motif) domain 0.0044
Further Details:      
 
Domain Number 4 Region: 178-247
Classification Level Classification E-value
Superfamily Cysteine-rich domain 7.33e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000265
Further Details:      
 
Domain Number 5 Region: 118-174
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000478
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000022105   Gene: ENSLACG00000007561   Transcript: ENSLACT00000025637
Sequence length 1176
Comment pep:known_by_projection scaffold:LatCha1:JH126822.1:223642:331445:1 gene:ENSLACG00000007561 transcript:ENSLACT00000025637 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAYWSGTQTIIKEGMLMKQTNSFQRWKRRYFKLRGRTLYYAKTAKSIIFDEVDLTDASV
AESSTKNVNNSFTIITPCRKLILCADNRKEMEDWIAALKSVQNGEHFESTQYSMDHFSGM
HNWYACSHARPTYCNVCREALSGVTSHGLSCEVCKFKAHKRCAVRATNNCKWTTLASIGK
DIIEDEDGISMPHQWLEGNLPVSAKCTVCDKTCGSVLRLQDWRCLWCKAMVHTACKELLP
TKCPLGQCKVSVIPPTALNSIDSDGFWKATCPPSCTSPLLVFVNSKSGDNQGVKFLRRFK
QLLNPAQVFDLMNGGPHLGLRLFQKFDTFRILVCGGDGSVGWVLSEIDNLNLHKQCQLGV
LPLGTGNDLARVLGWGSACDDDTQLPQILEKLERASTKMLDRWSIMVYETKLPRQASSFT
VTEDYSEDSEVQQILFYEDSVAAHLSKILTSDQHSVVISSAKVLCETVKDFVARVGKAYE
KTTESSEESEVMARKCSVLKEKLDSLLKTLSDESQAAPSRPNPPPTIAEEQEDGEGSGNT
CESTSERSTTAACSTRPQIFRPREQLMLRANSLKKAIRQIIEHAEKAVDEQNAQTQEGFL
LSLSSEEQLRVARNEEKILLQSSHSSNYTSSVHKGKSCRKVPKPPCERLISKGSLSLGST
ASLPAQTGYRDNMPMLNAKILYPNFRPGMSGSLPGSSVISRLLISADPCNAEPESMDCYT
EKCVMNNYFGIGLDAKISLDFNNKRDEHPEKCRSRTKNMMWYGVLGTKELLHRTYKNLEQ
KVLLECDGRPIPLPSLQGIAVLNIPSYAGGTNFWGGTKEDDTFTAPSFDDKILEVVAVFG
SMQMAVSRVINLQHHRIAQCRTVKITILGDEGVPVQVDGEAWIQPPGYIRIVHKNRAQTL
TRDRAFENTLKSWEDKQKCEIPRVSSQHALHPEIVSEDEALQINQFGQSAGALIHSIREI
ALSHHDMEQELAHAVNASSKSMDKVYAKSKTTEGLNCGLVIEMVNNVKALHNETELLLAG
KMSLVLDPPQKEQLSSALANVDLQFRKLTEIPWLCQLVEPSDEESQMMDYSKRTRSAKFR
LVPKFKKEKNNKNKEMRSSMALPVHLWGTEEVAAWLEHLSLCEYKDIFIRHDIRGSELLH
LERRDLKDLGVTKVGHMKRILHGIKELSRSSPVSEV
Download sequence
Identical sequences M3XH99
ENSLACP00000022105 ENSLACP00000022105 XP_005995564.2.90931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]