SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000022405 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000022405
Domain Number 1 Region: 1951-2121,2161-2301
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 2.06e-37
Family Hypoxia-inducible factor HIF ihhibitor (FIH1) 0.06
Further Details:      
 
Weak hits

Sequence:  ENSLACP00000022405
Domain Number - Region: 1615-1647
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00492
Family TFIIH p44 subunit cysteine-rich domain 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000022405   Gene: ENSLACG00000011597   Transcript: ENSLACT00000026524
Sequence length 2313
Comment pep:known_by_projection scaffold:LatCha1:JH126969.1:646089:692383:1 gene:ENSLACG00000011597 transcript:ENSLACT00000026524 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVVMNDQVLEPQNVDPSMVQMTFLDDVVHSLLKGENIGITSRRRSRSNQTNNTAHGHYTR
AQANSPRPAMNSQTVTPKQNQLPQQQQQQQQQRNVRSHKRKGSDSSVPDEDKTKEEKVDN
MGRGEFSKTKNKQIVKRRKPEEEEKKVDLKRPKEENALDCYESSDSENSNKKLIDSSSEQ
NSENELKNMSASKSCEQEGESQCSEGAEETTLIDRHSPWDEIQEDEKACKAERFQSADSE
VEEKPPLQPVGSPALHDQNISTLGVQGCIAETKTVELLPKEHSVCVSPTSESGGDEKSLS
EMAQENNNFSVQAAQKLEFYGNDLKQSVETPGGSDKRDTEFGQHLDSSVISKTDSVHSEV
MKTVSVVNESPAWTDQEKLHYGSVMPTVGAISSEEGVKKLHKSTPSPDILKPKANTSPVI
TKSKSGTCPDTHKHKLSTSPDTLKPKANYQSSQAVSFTRAVSKIECELPRSSFHSVTARL
RATDVTKSPLIIDKNEHFTVYRDPTLVGPEPEANHVSAYLHQHVHPLHASTHATCITPNT
HHPTLSAPIAAINAHLLSSASHHHHPHLLQAVLPGVPPASLIGGHSRLDSTHASNLSHLA
QAHHQQQQLLQHQSPHLLGQTHAAASYNQLGLYPIIWQYPNGTHPYPRLSLPSSKWVHPE
NSMNTEASLRRNTPSPWLHQPTPVSSADSLGLLSHIPVRPASTDLPRPLKLAMHSSPPLS
KAAVDHHKEEMEKKSFVEPLRSITPVPVKSDLDHSRSHIGKESHLHRHFMDPGPSHNKKQ
RPLLETGDRQNKYKEENRRILQESIEVAPFTAKIKATEGGKDPYSRIVALPIISPKGQVL
KQEKDVERSVEDLFKLKHALQTLPQSNYFTTLSNSVVNEPPQSYPSKEAANLYGEKHSGN
PSMVSSPQSVTSFNSKSLSKPPPLIKHQSEGEGLVGKITEQLSQQVASHTVNSNNIDCRN
STQLSVSPLNPLRSMPALHRAPVFHPPIQQNLERKESNYGSLSPPMLTPVQPVNAAGKLA
ESQKPPTLIPELKDINSTYKINHEMISLEIHKGSDTVSHEKSEWHLEKRNGKPQAATASV
IVRPPSSMKYDSVPVTQSASKDPVSERLLTETNHMDCLKTTEARETGSVILPNINSISTC
TPYGKHFQAFSQGNFPSSVIAAASIMCSIKTEVTTSATTTTSVLSQGGSDVTYSVLASPR
QESATPRTVLHSAAQSQECKVSTTATTDFLPINTKTGTTAQAISGGSKITDFIHLKKHKA
ALAAAQSRSTNSNENEPATAKVQKCSGIISHDSTAVSSTTNKANSVSNGQSAQLTQPNYH
TKLKKAWLTRHSEEDKNTNKVEKIESTVSEIIKPCSVNLIASTSNEVENSKILEEKAVKE
DKITKKGTKRTFESGSESDDSDESESKSEQRAKRQPKPTYKKKQNDLQKKRSDAEKEEEE
IRPNGILSRSAKEKSKLKLQNSNTSNGIPRSVLKDWRKVKRLKQTGESFLQDDSCSEIGP
NLQKCRECRMVRNKKAEEPTHSPVFCRFYYFRRLSFSKNGVVRIDGFSSPDQYDEEALSL
WTPDDSEENELDMDTCKYILDNIGDKFCQLVMSEKTAMSWVKKDAKIAWKRAVRGVREMC
DACEATLFNIHWVCQKCGFVACLDCYKAKERKSSRDKELYAWMKCVKGQPHDHKHLMPTQ
IIPGSVLTDLVEAMHTLREKFGIKSHCLCSNKPSIQCGKLPVTNGVSQVLQNVLNHSNKI
SLCLPESQQSATQKPEMNGSVSPGSNKSTDSKLTPPESQSPLHWLADLAEQKSREEKKEN
KGSSLDKQMEERDQADRTESLSCKASPPVSHSCEQGSTLRDLLTTTAGKLRLGSTDAGIA
FAPVYSSGNSACKGGRNMPNILDDIIASVVENKIPAKQMPKLNLKVDQKEETKNCKKSAL
DEYNKLHSDIPHSWLCDKRLLWLKDHKNRRNMNIFRDCWRRGLPVLVSGVHKKMNSNLWK
AELISQEFGDQQADLLDCKDGIISNANIKEFWDGFEDITKRPKVKSGETVVLKLKDWPSG
EDFRVMMPSRYDDFMKMLPLPEYSNPEGNLNLASYLPGFFVRPDLGPRMCSAYGVAAAKD
QETGTTNLHVEVSDILNILVYVGVARGNGVLSKTGVFKKLEEEDLDDLIKRRLKDSSETP
GALWHIFDSKDIEKIHELLQKVAKEQGLDVPPEHDPIRDQSWYLNKKLRERLLEEYGVKT
LTVVQFLGDAVILPAGTLHQVQNLHSCIQVIEEFVSPEHLVESFHLTQELRPSKDEINYD
DKLQVKNILYHSVKEAVGALKVHEEEMENTEEN
Download sequence
Identical sequences M3XI49
ENSLACP00000022405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]