SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000022419 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000022419
Domain Number 1 Region: 841-1118
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000000796
Family Rhodopsin-like 0.032
Further Details:      
 
Weak hits

Sequence:  ENSLACP00000022419
Domain Number - Region: 464-524
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.000942
Family Hormone receptor domain 0.0034
Further Details:      
 
Domain Number - Region: 192-308,354-382
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.0128
Family YVTN repeat 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000022419   Gene: ENSLACG00000003578   Transcript: ENSLACT00000025883
Sequence length 1417
Comment pep:known_by_projection scaffold:LatCha1:JH127484.1:88462:318451:-1 gene:ENSLACG00000003578 transcript:ENSLACT00000025883 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASFGSKLQTHWWLIFLCCCLQSTQGFSRSALPFGLVRRELSCEGYPIDLRCPGSDVIMI
ESANYGRTDDKICDADPFQMENTDCYLPDAYKIMSQRCNNRTQCIVITGSDVFPDPCPGT
YKYLEVQYECVPYIFVCPGTLKAVVDSPYIFEAEQQAGAWCKDPLQAADKIYFMPWTPYR
TDTLIEYASLEDFKNGRQTTTYKLPNRVDGTGFVVYDGAVFFNKERTRNIVKFDLRTRIK
SGEAIINNANYHDTSPYRWGGKTDIDLAVDENGLWVIYATEQNNGMMVISQLNPYTLRFE
ATWETTYDKRSASNAFMICGVLYVVRSVYEDNESEMGKNAINYIYNTKITKGEYVDIPFP
NQYQYIAAVDYNPRDNQLYVWNNYFTLRYSLEFGPPDPAQVPTIVVTTLSPAEISKTTLA
TTTTTSQKGLLTTTSAGGMREGSRGPKPSPVIPVTRIPPVTSFFPLPERFCDPTEARGIN
WPQTQRGVVVEWPCPKGTRGTASYLCMVSTGMWNPKGPDLSNCTSHWVNQVAQKIRNGEN
AANLANELDRHTKGPIFAGDVSSSVRLMEQLVDILDAQLQELRPSEKDSAGRSFNKLQKR
ERTCRAYIKAIVGTVDNLLRPEALESWKDMNSTEQTHAATMLLDTLEEGAFVLADNLIEP
ARVTVPAENIVLEVAVLSTEGQVQHFRFPQGNKGGNSIQLTANTVKQNSRNGLAKLVFIL
YKSLGQFLSTENATIKLGNDVSIGNSTIAVNSHVIAASINKESSRVYLTDPVHFTLKHID
PNNYFNANCSFWNYSERIMMGYWSTQGCKLIDTNKTHTTCACSHLTNFAILMAHREVMYK
DRVHELLLTVITWVGIVISLVCLAICIFTFCFFRGLQSDRNTIHKNLCINLFIAEFIFLI
GIDKTNYEIVCPIVAGLLHFFFLAAFSWMCLEGVQLYLMLVEVFESEYSRKKYYYVSGYL
FPATVVGVSAAIDYKSYGTEKACWLTVDNNFIWSFIGPVTFIIMLNLLFLVITMYKMVKN
STTLKPDSSRLENIKSWVLGAFALLCLLGLTWSFGLLFVNEESVVMAYLFTIFNAFQGMF
IFIFHCALQKKVRKEYSKCFRHSHCCGGLPSESSHSSVKASTTRTSTRYSSGTQSRIRRM
WNDTVRKQSESSFISGDINSTSTLNQGHSLNNARDTSAMDTLPLNGNFNNSYSLRNGDYN
DSVQVVDCGLSLNDTAFEKMIISELVHNNLRGSSKNHNIERALPTKVVIGGSSSEDDAIV
ADASSLVHCDNPGLELHHKELEAPLIPQRTHSLLYHPQKKVKTEATDSYVSQLTTEAEDH
LQSPNRDSLYTSMPNLRDSPYPESSPDVEEDLSPSRKSESEDIYYKSMPNLGAGHQLQMY
YQISKGNSDGYIIPINKEGCIPEGDVREGQMQLVTSL
Download sequence
Identical sequences M3XI63
ENSLACP00000022419 XP_014348444.1.90931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]