SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000023195 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000023195
Domain Number 1 Region: 169-386
Classification Level Classification E-value
Superfamily YWTD domain 0.0000497
Family YWTD domain 0.026
Further Details:      
 
Domain Number 2 Region: 824-1107
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000613
Family Rhodopsin-like 0.034
Further Details:      
 
Weak hits

Sequence:  ENSLACP00000023195
Domain Number - Region: 464-520
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.00157
Family Hormone receptor domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000023195   Gene: ENSLACG00000001437   Transcript: ENSLACT00000025863
Sequence length 1416
Comment pep:known_by_projection scaffold:LatCha1:JH126931.1:17532:908397:-1 gene:ENSLACG00000001437 transcript:ENSLACT00000025863 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWTSQLLIFIMLVAPEVSAFSRAPIPMAVVRRELSCESYPIELRCPGTDVIMIESANYGR
TDDKICDADPAQMENIRCFLPDAFKIMSQRCNNRTQCAVIAGPDVFPDPCPGTYKYLEVQ
YECVPYIFLCPGMLKGVYQSEHLFESDHQSGAWCKDPLQASEKIYYMPWTPYRTDTLTEY
SSKEDFVAGRPTTTYKLPHRVDGTGFVVYDGALFFNKERTRNIVKFDLRTRIKSGEAIIA
NANYHDTSPYRWGGKSDIDLAVDENGLWVIYATEQNNGRIVISQLNPYTLRVEGTWDTAY
DKRSASNAFMICGTLYVVKSVYEDDDNEATGNKIDYIYKTDVSEDGYVSVPFPNSYQYIA
AVDYNPRDNLLYVWNNYHVVKYSLDFGPLDSKPESSTSAPVAMGTTTTRAPPRSSVNSPT
KSTTVSGRRNKITTTTPTPTVEKILEETVTWPQPASSQLPAIGAEYCEAAETREVLWPRT
RQGMLSKQPCPPETKGVATYMCLAPEGIWDPLGPNLSNCTSPWVSQITDKLRYGEIAANI
ARELAEKTKKRLHAGDITASVRAMGQLVNVLDLQLRNLTPGGKDSAARSLNKAMVETVNN
LLQPQASKAWKDLTTSDQLHAATMLLDTVEEGAFVLADNLLKTDIVRETTDNIKLEVARL
STDGNLEDLKFPQNEGHGNSIQLSASTLRQNGRNGEIRVAFVLYNNLGSYLPTENASVKL
GSEAKSTNHSVIVNSPVITAAINKDYSSKVYLADPVIFTVKHIKQSEDNFNPNCSFWSYS
KHTMTGYWSTQGCRLMETNKTHTTCSCNHLTNFAVLMAHVNVQNTDEVHNLLLDVITWVG
ILLSLVCLLICIFTFCFFRGLQSDRNTIHKNLCISLFVAELLFLIGINRTDQPIACAVFA
ALLHFFFLAAFTWMFLEGVQLYIMLVEVFESEHSRKKYFYLVGYGVPALIVAVSAAVDYR
SYGTDKVCWLRLDTYFIWSFIGPATLIIMLNVIFLGIALYKMFHHTAILKPDSGCLDNIK
SWVIGAIALLCLLGLTWAFGLMYINESTVIMAYLFTIFNSLQGMFIFIFHCVLQKKVRKE
YGKCLRTHCCSGKSTESSIGSGKTSGSRTPGRYSTGSQSRIRRMWNDTVRKQSESSFITG
DINSSASLNREGLLNNARDTSVMDTLPLNGNHGNSYSIASGEYLSDCVQILDRGYNHNET
ALEKKILKELTSNYIPSYLNNHERSSEQNRNLMNKLVNNIGSGSEDDAIVLDDATSFNHD
ENLGLELIREESDAPLLPQRAHSTENHQPHHYTRRRIPQDNSESFFPLLTNEHTEELQSP
NRDSLYTSMPALAGMPPTDGTTTDTQTVPPSAKSGDADDVYYKSMPNLGSRNHVHQLHTY
YQLGRGSSDGFIVPPNKDGAPPEGDSKGPSHLVTSL
Download sequence
Identical sequences M3XKD9
ENSLACP00000023195 ENSLACP00000023195 XP_014344599.1.90931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]