SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000023483 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000023483
Domain Number 1 Region: 223-384
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 1.47e-45
Family Pentapeptide repeats 0.00019
Further Details:      
 
Domain Number 2 Region: 95-195
Classification Level Classification E-value
Superfamily POZ domain 2.94e-27
Family Tetramerization domain of potassium channels 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000023483   Gene: ENSLACG00000016937   Transcript: ENSLACT00000026331
Sequence length 395
Comment pep:known_by_projection scaffold:LatCha1:JH126671.1:1816975:1841675:-1 gene:ENSLACG00000016937 transcript:ENSLACT00000026331 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFRVEGKQSVFQTDREQIKDLVVAVYGTLSDLLSVASNKLGIKASYLYNGKGGLIDDIA
LIRDDDVLYVSEGDSYIDPQTDPGTAEELTGSYTDWLTLNVGGRYFTTTRSTLVNKEPES
MLAHMFRDKDAWGNKQDHKGAFLIDRSPEYFEPILNYLRHGQLIVNEGINLMGVLEEATF
FGIESLIEQLDVAIKTSQPADDHSPISRKEFVRFLLATPTKLELRCQGLNFSGADLSKLD
LRYINFKMANLSRCNLSHVNLCCANLERADLSGAVLDGANLQGVKMLCSNAEGASLKGCN
FEDPSGLKANLEGANLKGVDMEGSQMTGINLRVATLKNAKLKNCNLRGATLAGTDLENCD
LSGCDLQEANLRGSNVKGAIFEEMLTPLHMSQSVR
Download sequence
Identical sequences M3XL77
ENSLACP00000023483 XP_014341525.1.90931 ENSLACP00000023483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]