SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000002761 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000002761
Domain Number 1 Region: 20-231
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 1.79e-33
Family AlkB-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000002761   Gene: ENSLACG00000002470   Transcript: ENSLACT00000002783
Sequence length 243
Comment pep:known_by_projection scaffold:LatCha1:JH126578.1:49954:74093:1 gene:ENSLACG00000002470 transcript:ENSLACT00000002783 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDSPSSLDHLESFRVEQAPPTVHYIPSFISESDEQLILQQVYSAPKPKWTQLSGRRLQN
WGGFPHPKGMVAEKLPDWLEKYTEKVSSLGVFGGKVANHVLINEYNPMEGIMPHEDGPLY
FPTVTTISLGSHALLDFYQPISKKEKTEQAVGDNESCPQMEENRYFLSLLLAPRSLLILQ
DDMYVQYLHGIKPVREDVVTEKIVNLGSCDVKPGDVLTRGTRVSLTIRHVPKVLKTTILL
GRR
Download sequence
Identical sequences H2ZZE0
ENSLACP00000002761 ENSLACP00000002761 XP_005987841.1.90931 XP_005987842.1.90931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]