SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000002778 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000002778
Domain Number 1 Region: 682-811
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000000276
Family Synaptotagmin-like (S variant) 0.0059
Further Details:      
 
Domain Number 2 Region: 11-47
Classification Level Classification E-value
Superfamily WW domain 0.000000000000757
Family WW domain 0.001
Further Details:      
 
Domain Number 3 Region: 63-97
Classification Level Classification E-value
Superfamily WW domain 0.00000000236
Family WW domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000002778   Gene: ENSLACG00000002484   Transcript: ENSLACT00000002800
Sequence length 1172
Comment pep:known_by_projection scaffold:LatCha1:JH126997.1:50366:285305:1 gene:ENSLACG00000002484 transcript:ENSLACT00000002800 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGVSSSWRRESSELPLPSGWEEARDYDGRVFYIDHNTRQTSWIDPRDRITKPLTFADCV
GSELPLGWEVVYDQQIGVYYIDHINQITQIEDPRAQWRREQERMLKEYLVVAQEALNAKK
EIYQIKQQRLELAQAEYQQLHEMCEEDSRSHTSSYSGSSSNTKYDLDQIKAEIASRRERL
SRLKRELAQMKQELQYKEKGVETLQEIDRKMSNNQNSYKLDEAQAIMNELRTIKKAISTG
EKERQDLIQSLAKLTDGFQNSCCITHSLQDFRNNFGSLSDSCLPQQYCDAESQTDIIGEF
GHDERTRLADKMKLNWQYEEAKKRVSSLQHQLAQMDNETWPGMAEADRDRLQVIKEKEAL
LQELQLISQQRRSPDDIVRLEAEKRRLEEEIQRARSSSTQGAAERILLQEKRNCLLKQLE
EATRLATYLQSQLKSLSASTLTVSSGSSRGSLASSRGSLASSRGSLSSISFTDIYGLPQY
EKTDALTDFSQHLRFDLIPFDAVCKDALHSDTVGLSNLSKQRRSLDTPQSLASLSSRSSL
SSLSPPSSPLDTPYLSASRDSPLAQMTEEFEEFTGRGALENLRGQTHPGNEDTHGAASSQ
SPGYHRDNKGTKDVSPKLGSVAQGPSVVTLRTDSARRSGRRARRVSAGLSDDSLASDSGV
FEALNKRTEDAEESVYNDAASNEAPQIQVGTMYDSGNECLVVHVLHLKNFPAFTAKEGCR
IYIRVYLLPLDPSSTSTYCSKALEFQTQLTFSEAFRIPVHSSVLRLKSLQLYVCSMDHQA
QEELLGLVQISLPDPEGSSEMLLQWYLVQSFSSMETQKKRNSSQFGESSLESTGNKTAVK
TDAVSALLARTTAQLEAVERELAEERVKLEYTEEEILEMERKEDLAEAESERSWQAESVD
SGCSNSMQISPNYPEGLCGEHGPGSVFGGQVSQYVVVKAQTPPTKVDKETNTEDPFPEEI
AVRPKERSNRRSRGSPFVRSSTIVRSQTFSPGARSQYVCRLYRSDSDSSTLPRRSPFIRN
TLERRTLRYKQQSYRSSLVEHPTRTSLDLELDLQASRTRQRQLNEDLSTLRELRQRLDEA
QLRGQTELPQWVLRDERFRNLLREAERQAKQSQPERCQEQAAERLLKKASKEVFQLRGQN
QKEPQQVQTFREKIAFFTRPRINIPPLPADDV
Download sequence
Identical sequences H2ZZF7
ENSLACP00000002778 ENSLACP00000002778 XP_005998281.1.90931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]