SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000002944 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000002944
Domain Number 1 Region: 364-749
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 1.12e-121
Family Oxysterol-binding protein 0.0000365
Further Details:      
 
Domain Number 2 Region: 110-229
Classification Level Classification E-value
Superfamily PH domain-like 1.57e-23
Family Pleckstrin-homology domain (PH domain) 0.000000637
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000002944   Gene: ENSLACG00000002635   Transcript: ENSLACT00000002969
Sequence length 855
Comment pep:known_by_projection scaffold:LatCha1:JH129609.1:54766:111092:-1 gene:ENSLACG00000002635 transcript:ENSLACT00000002969 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPQDTGKKVESKVKPIIREKKKHMRTLCKRSPQAKGFDRGKEDVSQSKDDVTHSISKSKS
ESKLYNGSEKDISATGNKLTKKESLKVQKKNYREEKKRATKELLSTITDPAVIVMADWLK
IRGTLKSWTKLWCVLKPGVLLIYKTPKNGQWVGTVLLNACELIERPSKKDGFCFKLFHPL
EQSVWAVKGPKGEAVGSITQPLPSSYLIFRAASESDGRCWMDALELALKCSSLLKRTMIR
EGKEHDSNSSAESTHVALFGLLRANNIQGGESFQLNDSEIERQHFKDQDDLYSDKSDKEN
EPDHEESDNDVLGKSEESDTDTSERQDDSYVDPDPTDIVKETTYVEQTSEELGEAGEASQ
TEVVSEENKGLIWTLLKQVRPGMDLSKVVLPTFILEPRSFLDKLSDFYYHANFISEAAVE
ENPYNRMKKVVKWYLSGFYKKPKGLKKPYNPIIGEIFRCLWIHPETNSKTFYIAEQVSHH
PPVSAFYISNRKDGFCLSGSILAKSKFYGNSLSALLDGEARLTFLNRGEDYVMTMPYAHC
KGILYGTMTLELGGTVTIACEKTGYSAVIEFKLKPFLGSNDSVNQISGKIKLGKEVLATL
EGQWDTEVIIHDKKTDLIETFWNPTPEIRQRRLTRCTVLFEEQGEFESEKLWQHVTRAIN
SKDQMEATNQKYILEEAQRKAAKERKLKYEEWTCSLFEQDLVTGEWHYKYADTRPWDPLN
DLIQFEKDGVIQTKVRHRTPMVVVPKIKRKPTGQKKNAVSGFSSPELNRQDSSGSETLSN
KQKKKKKKRPEYHCPKPCPAFLRMSCAFILRNLMVLRTRSFMSQTPSDSGFLQQRDIIVI
FLLILLQIVINYLFK
Download sequence
Identical sequences H2ZZX3
ENSLACP00000002944 ENSLACP00000002944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]