SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000003499 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000003499
Domain Number 1 Region: 132-166
Classification Level Classification E-value
Superfamily WW domain 0.0000000000771
Family WW domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000003499   Gene: ENSLACG00000003120   Transcript: ENSLACT00000003530
Sequence length 643
Comment pep:known_by_projection scaffold:LatCha1:JH128627.1:71226:219791:1 gene:ENSLACG00000003120 transcript:ENSLACT00000003530 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVMYARKQPRLSDGCHDRRESQPYQTLKYPSKSHPSSGDHRHDKMRDATDPSPPNKMLRR
SNSPETKYGDGTGHSKQKTIHAHRVRERDGGTSYSPQENSHNHSVHSSNSHSSNPSSNPS
KTSDAPYEPADDWSEHISSSGKKYYYNCRTEVSQWEKPKEWMEREQRQKEASKLAVINSF
PKDRDYRREAMQATTTGGFSSGMEEKHASDAGSMLPQNILSQTSRHNDRDYRLPRAETHS
CAATVQHPIKPVVHPTAAPSTVPSSPFTLQSDHQPKKSFDANGAATLSKLHTPTSSIPVQ
KTERKESTSLEKSASHSCSTSSASSSSGLNPAATQSSSTSTVPVSPVPQSPIPPLLQDPN
LLRQLLPALQATLQLNNSNVDMSKINEVLTAAVTQASLQSILHKILTAGPSAFNITTLLS
QAAQLSTQAQPSNQSPMSLTSDASSPRSYVSPRISTPQTNTVPLKPMISTPPVSSQPKVS
NPVVKQGPAPQPVPPVAVDKQHGHDAASPRSLQRSSSQRSPSPGSNHTPSSSASSTAAVP
PNTSTRPPCSFTPTLAAHFNENLIKHVQGWPADHAEKQAARLREEAHNMGSIHMSEICTE
LKNLRSLVRVCEIQATLREQRILFLRQQIKELEKLKNQNSFMV
Download sequence
Identical sequences H3A1H8
XP_006009610.1.90931 ENSLACP00000003499 ENSLACP00000003499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]