SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000003752 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000003752
Domain Number 1 Region: 44-84
Classification Level Classification E-value
Superfamily WW domain 0.0000000000000712
Family WW domain 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000003752   Gene: ENSLACG00000003343   Transcript: ENSLACT00000003786
Sequence length 324
Comment pep:known_by_projection scaffold:LatCha1:JH128592.1:79824:148874:-1 gene:ENSLACG00000003343 transcript:ENSLACT00000003786 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCCLSVLLRLFSHIDQTTTWQDPRKALLPQMNVTAPTSPPVQQNIMSPSSGPLPDGWEQA
MTQEGEIYYINHKNKTTSWLDPRLDPRFGINQQRMSQSAPVKQAPPLAPPSPQSGVMGGS
NQQQQMRLQQLQMEKERLRLKHQELLRQVRPQFYPSSGSQKFCSELALRSQLPTMEQDGG
SQNPVSPPGMSQDVRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSV
DEMDTGDTIGQSNLASQQNRFPDYLETIPGTNVDLGTLEEDGMNVEGEELMPSLQEALST
DILNDMESVLAATKIDKETFLTWL
Download sequence
Identical sequences H3A281
ENSLACP00000003752 ENSLACP00000003752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]