SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000004758 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000004758
Domain Number 1 Region: 480-775
Classification Level Classification E-value
Superfamily L domain-like 1.6e-45
Family Ngr ectodomain-like 0.0058
Further Details:      
 
Domain Number 2 Region: 42-80,119-398
Classification Level Classification E-value
Superfamily L domain-like 2.58e-35
Family Ngr ectodomain-like 0.0028
Further Details:      
 
Domain Number 3 Region: 868-1022
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 3.14e-34
Family Toll/Interleukin receptor TIR domain 0.0000671
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000004758   Gene: ENSLACG00000004229   Transcript: ENSLACT00000004799
Sequence length 1033
Comment pep:known_by_projection scaffold:LatCha1:JH130477.1:114058:119376:1 gene:ENSLACG00000004229 transcript:ENSLACT00000004799 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HLSFQSRLLWCSFLLRGGSWWQCVQEKFPKTLPCDVNVTERSILLDCSERHLTKIPKGIP
ANATNITLSINHIPNVFKTSFSGLEDLKEIDFRCNCMPVKIGPKDQICTKRLHVQEDSFR
SLKSLKSLYLDGNQLSEIPRGLPPNLALLSLEVNNIYSIRSENLSELSNLESLYLGKNCY
FRNPCNVSFFIENGAFSNMSNLLILSLKADNLTNVPQNLPPSLRQLYLYNNMIQKINKMD
FANLVHLEILDLSGNCPRCYNAPFPCTPCPGQVSIQIHPSAFKELRNLRILRLHSNSLRS
VTSEWFHNTPLLQVLELSQNFLAKEIGEAKFLNFLGKLEELDLSFNYALQVYATSLTLSK
TFSNLTYLKTLRLRGYVFKELKRDDLQPLFGLRYLEVIDFGTNFIKITNLNFVRDFPALR
ILYLAENKISPTSSGSMFGSCSISSPSVSHFSPGILGGVHYFKYDEYGRSCKMECSNYGK
TLDLSGNNIFFINPEQFQDLTFLACLNLSGNAMSQTLNGSEFQNLPNLKFLDFSNNRLDL
LHWTAFQELKKLEVLDISVNKHYFEAEGVTHMLNFTMGLPALKKLKMNQNEISTSTNRKL
KSLSLEVLEFKGNRLDILWKDGDNRYLEFFKELSNLTVLDISYNSISFVPPPVFKNMPPN
LLELYLNNNGLKSFNWGKLHFLRKLITLDLSNNALKTVPRELSNCTKHLQKLILRNNKIP
KLTKNFLRDAYSLRYLDLSENKIQIIEQSSFPEKVLNKMEVLLLNGNQFLCTCDAVSFIW
WIQHTTVNIPRLATDVICAGPGVHQGESVISVDLNTCYLDSLALILYSLSASVIIFLLVV
TISSHLFFWDVWYSYHFCAAKFKGYHPLVSQSTCYDAYIAYDVKDPDVADWVFKELRIQL
EEQGDKYFNLCLEERDWIPGHPIIDNLSQSIQLSRKTVFVLTDRYVRSGSFKMTFYMAHQ
RLIDEKLDVIVLVFLEKALQKSKYLKLRKRLCSSSVLDWPTNPQAQRYFWQCLKNALATD
NRMQYSKLFQETL
Download sequence
Identical sequences H3A537
ENSLACP00000004758 ENSLACP00000004758

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]