SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000004891 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000004891
Domain Number 1 Region: 1-86
Classification Level Classification E-value
Superfamily Hormone receptor domain 8.76e-23
Family Hormone receptor domain 0.00025
Further Details:      
 
Domain Number 2 Region: 64-211
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000906
Family Rhodopsin-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000004891   Gene: ENSLACG00000004349   Transcript: ENSLACT00000004934
Sequence length 218
Comment pep:known_by_projection scaffold:LatCha1:JH127074.1:126258:145042:-1 gene:ENSLACG00000004349 transcript:ENSLACT00000004934 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GCRGLWDNITCWPSAVVGEMVVKQCPIYFSYFANAHGNVSRMCTSHGWTELYPAPYAAAC
GYDTNSTPTEEAVFFDVVRIGYTVGHSLSLISLTAAMIILCIFRKLHCTRNYIHMHLFVS
FIMRAVAVFVKDVVLFENGESDHCFVGSTGCKAAMIFFQYCIMANFFWLLVEGLYLHTLL
VISFFSERKYFWWYILIGWGAPLVFITAWTITRIHFEN
Download sequence
Identical sequences H3A5H0
ENSLACP00000004891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]