SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000005071 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000005071
Domain Number 1 Region: 1218-1549
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 2.75e-75
Family Hect, E3 ligase catalytic domain 0.000000537
Further Details:      
 
Domain Number 2 Region: 808-845
Classification Level Classification E-value
Superfamily WW domain 0.0000000000025
Family WW domain 0.0013
Further Details:      
 
Domain Number 3 Region: 988-1030
Classification Level Classification E-value
Superfamily WW domain 0.000000000144
Family WW domain 0.0013
Further Details:      
 
Domain Number 4 Region: 211-310
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000015
Family PLC-like (P variant) 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000005071   Gene: ENSLACG00000004512   Transcript: ENSLACT00000005117
Sequence length 1549
Comment pep:known_by_projection scaffold:LatCha1:JH128500.1:125972:388921:1 gene:ENSLACG00000004512 transcript:ENSLACT00000005117 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSSHLFFQNLYQNRLLGLAAMASPSRSSQNRRRCKEPLRYSYNPEQFHNMDIENRPHGTL
NIPRSTSDTDLVTSDSRSTLMVSSSYYTIGQSQDLVICWDIKEEVDAGDWIGMYLIDEAL
SENFLDYKNRGVSGSHRGQIVWKIDPSSFFVESETKICFKYYHGMSGGLRATTPSVTVKN
PSAPVFKNITSEDVAPGQGSRRLISFKLSDFQAVGLKKGMFFNPDPYLKISIQPGKHSIF
PALPHHGQEKRSRIGFNTINPVWQGEQFSFVSLPTDVLEIEVKDKFAKSRPIIKRFLGKL
SMPVQRLLERHAIGDRVVSYTLGRRLPTDHVSGQLQFRFEITSSIHPDDEEISSSTEPES
TGHQEDTVMQEIPTEDPYVTTDNPQNTELEQLDAYEENNMNRSDHETTESPAEASHINID
EPVDGSVEVKSELADAALLRDSTPTEGPNEDQSPLTNSALTEPQDPTRRLISEVEGTNCV
ITQGDSVIDSPSESNMQEVGQVEPVNLENENEECTSEPETLTQQEESTLRLRTSAKRKIR
PCSLPVSELETVIASACGEPETPRTHYIRIHHLLHSLPSAQITDDAGDEIGIVDSEESLD
KDDVNKDITNETETTSELLNDVTVEDVNENHRTLPRSASVERLSDIHQLTDNEQSRTESE
SSPRPLGDNECDICDTSCYSTSCNSTSCYSTSCYDSTNRFSSHTRFSSVDSARISESTVF
SSQDDEEEENSAFESVPDLMQSPEQVSNSSLWPEEPEAEGGSPQRTTENRESPVAGPSNI
TVGDCPLPYNSPPITQLPAFRTDHHHFPAIDEPLPPNWEARIDSHGRVFYVDHVNRTTTW
QRPTTAATPDGMRRSGSVQQMEQLNRRYQNIQRTIATERTEDEAGGQRTERLFGGNGDAD
ANLAQTSSEQRRELPLSPMNSAKITLLLQSPAVKFITNPEFFTVLHANYSAYRVFTNSTC
LKHMILKIRRDARNFERYQHNRDLVAFINMFADTRLELPRGWEVKTDQQGKSFFVDHNSR
ATTFIDPRVPLQNGRLPNHLTHRQHLQRLRSYSAGEASEVSRSRGASLLARPGNSLVATI
RNRHLHEAVPVAYNDKIVAFLRQPNIFDMLQERQPSLARNHALREKIHYIRTEGAPGLEK
LSCDADLVILLSLFEEEIMSYIPLQSSFHPGYSFSPRCSPGSSPQSSPGLQRASARAPAP
YRRDFEAKLRNFYRKLEAKGYGQGPGKIKLIIRRDNLLEGTFNQVIAYSRKELQRNKLYI
TFVGEEGLDYSGPSREFFFLLSQELFNPYYGLFEYSANDTYTVQISPMSAFVENHLECFE
KAQSSSSLLLILLLHSYTFFFLFLKIVPDAILALDSTSLWLLNLTFHNREEEGKKNFISQ
RVDLDFKLYKSIFIKVTERELKSGGANIQVTEKNKKEYIERMVKWRVERGMVQQTEALVR
GFYEVVDSRLVSVFDARELELVIAGTAEIDLIDWRNNTEYRGGYHDGHIVIRWFWAAVER
FNNEQRLRLLQFVTGTSSIPYEGFVALRGSNGLRRFCIEKWGKITSLPR
Download sequence
Identical sequences H3A600
ENSLACP00000005071 ENSLACP00000005071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]