SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000005182 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000005182
Domain Number 1 Region: 431-567
Classification Level Classification E-value
Superfamily TIMP-like 2.04e-30
Family Netrin-like domain (NTR/C345C module) 0.042
Further Details:      
 
Domain Number 2 Region: 211-306
Classification Level Classification E-value
Superfamily Immunoglobulin 4.21e-21
Family I set domains 0.015
Further Details:      
 
Domain Number 3 Region: 384-438
Classification Level Classification E-value
Superfamily BPTI-like 2.27e-20
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0029
Further Details:      
 
Domain Number 4 Region: 323-380
Classification Level Classification E-value
Superfamily BPTI-like 0.000000000000017
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.012
Further Details:      
 
Domain Number 5 Region: 125-175
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000873
Family Ovomucoid domain III-like 0.029
Further Details:      
 
Domain Number 6 Region: 39-88
Classification Level Classification E-value
Superfamily Elafin-like 0.000000101
Family Elafin-like 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000005182   Gene: ENSLACG00000004603   Transcript: ENSLACT00000005228
Sequence length 575
Comment pep:known_by_projection scaffold:LatCha1:JH128246.1:130029:132585:-1 gene:ENSLACG00000004603 transcript:ENSLACT00000005228 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPAFEMWWTLFPRWIWIVFGQTLVLRLLDVPTESLALPRVRYSHAGICPNDMNPNLWVDA
QSTCERECESDQECETFEKCCPNVCGMRSCVAARYMDVKGKKGPVGMPKEATCDRFMCTQ
QGSECDIWDGQPVCKCKDRCEKEPNFTCASDGLTYYNKCYMDAEACSKGITLNVVTCRYH
LTWPNTSPIPVETTARPTTAYSETTIIDVVQPTLVTNPVHQSVYMGETVSFLCDVTGRPK
PEITWEKQIDGKENIIMRPNHVRGNLVVTNIAQLVIYNAQTQDAGIYTCTAKNAGGRLTA
DFPLSVIKREPSFGDVTKNATQFSTEECLKLPDSEDCGEEQTKWYFDAKKNNCFTFAYGN
CNSNLNHFETYEACTSTCMNEPVNICNLPALQGPCKAYEPRWVYNSLLKQCQSFIYGGCG
GNENNFESKEACEEMCPFPKNNHCKACKPRQKMVTSFCKSDFVILGRMTELSEDQESGHA
LITVEEVLKDEKMGLKFLGKEPLEITLLNMDWNCPCPNMTTADSQVIIMGDVHNGMAVLQ
PDSFVGISSVRRVRKLREVIHKKTCDLLKEFPGLQ
Download sequence
Identical sequences H3A6B1
ENSLACP00000005182 ENSLACP00000005182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]