SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000005209 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000005209
Domain Number 1 Region: 1161-1356
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.18e-57
Family BCR-homology GTPase activation domain (BH-domain) 0.0000341
Further Details:      
 
Domain Number 2 Region: 946-1077
Classification Level Classification E-value
Superfamily PH domain-like 2.54e-30
Family Pleckstrin-homology domain (PH domain) 0.00000189
Further Details:      
 
Domain Number 3 Region: 49-166
Classification Level Classification E-value
Superfamily PDZ domain-like 2.1e-19
Family PDZ domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000005209   Gene: ENSLACG00000004627   Transcript: ENSLACT00000005256
Sequence length 1978
Comment pep:known_by_projection scaffold:LatCha1:JH128112.1:131094:420530:-1 gene:ENSLACG00000004627 transcript:ENSLACT00000005256 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATRRTGPSQEEEEEEERKQSHGSASETKHKDEREPSEAVSPAEEEIFSWPGPKTVALRR
NSQGFGFTLRHFIVYPPESAVQSSLKDEENGNRGGRQRSRLEPMDTIFVKQVKEGGPAYE
AGLCTGDRIVKVNGESIIGKTYTQVIALIQNSDSVLELCVMPKDEDVLQLLQFTGDIPVL
AYSHDAYLKGNDAYSGNAHYIPEPPPICYPRINTTAPAMAQPVDVPSPEPSESKQHSSRP
ARTLAQPDRGYRIEIPVPPSPSEIAKTNTAVCVCNETVRTVIVPSEKVLDLSCSRINRTG
PSHRTEEVRYGLPEQAGIKARTAVHPSVVATTSLQVPAGRSGESATVMTSGRYGNYGGYP
EGHSSSRSAHQVTEPCSVSTNHYSSPASHQNIDWKNYKTYKEYVDNRRLHTYGSRTIQER
LDSLRAAAQSTADYKKAAPTRTSAQVRRRSTSHDRTHQPMPIRYRSVSQERLAEPLLKKE
WPRSASQDTLTSPVIDSQNHRARSWDYLGRPSESLEGSPADNLAALPGGDVIQQKYSRSD
FAELKDCHSIYERPGQRVLHMSVRTQNLNMAPGAHSSDSRRVTSTIRNIAVSGPQFHKAS
DSKHFQPAYVGAQSAVVLQERSSRVTLQNATPSSLMSTVAPCTAKQGVFPAHNIDANALK
DQKAVSQLYHSGQHLQQRARSESVPEHQSESTMNIRSSSCSAPTSTKLVVQTIRSLQQDP
TSSTCGNVVPKELGVKQESSDKKDAVILREKPPSGRPTPQPLRHQSYILAVNDQEAVSDT
TCWLPNDARREVNIKRLGEQRKASGSSPPDDSLASIPFIDEPASPSIDHDITHIPASAVI
SVAAAQAPTITTIPPSPTSPTPFIRRQLSHDHESLRISILETQPTTKTERSKSYDEGLDN
YREEGKSSIKHVASLKGIKKATDSLKSSEDSGSRRDSSSDVFIDATKEGCLHFRQLVTEK
GKRVGGSIRPWKQMYVLLRGHSLYLYKDKKDQAAHASCPSDEEQPISIQACLIDISYSET
KRKNVFRLTTSDCEYLFQAEDRDDMLAWIRAIQENSNLDDEDTGVTSRDLISRRIREYNT
MMSKTEPSPKTPRQSLSIRQTLLGTKGEQKSQSPHSPKQDSDRKLLNKDDTSPPKDKGTW
RKGIPSIMRKTFEKKTSPGATFGVRLDDCPPAQTNKYVPLIVEVCCKLVEERGLEYTGIY
RVPGNNAAISNMQEELNKGMIDIDIQDDKWRDLNVISSLLKSFFRKLPEPLFTNEKYADF
IEANRREDSIDRLKTLKRLIHELPEHHFETLKFLSAHLKTVADNSEKNKMEPRNLAIVFG
PTLVRTSEDNMTHMVTHMPDQYKIVETLIQHYDWFFVEEGNEDSITPVQEENTVESQPVP
NIDHLLTNIGRTVASGDVSVDSATSDSARSKGSWGSGKDQYSKELLVSSIFAAASRKRKK
QKEKPQPSSSEDELDSVFLRKDTTEHIQNDMSKEYIHKGESEKQTNILGRKRLSYEVKEK
SVNKGIGLIADEEKEKSLPSEQASLSYHQKVHKSSNPGSQQMDVSKKPASRTFSQVEEIV
SDSDIMLHTSSQTSLQRLRSKKWASPEMKCNEFIAADVSSITSDYSTTSSTTYLTGFDSN
IISPEIQSVAESKGDEADDERSELISEGRPMETDSESDFSVFAASSASEKVLQGVNEKVK
LDRRSSEGSATGTEGSSTPKLDSRRLFGSHKLIEYDTLSRRKSGRHKNDSECSADAKAEK
EVQKTSRALDVMKGKSTSSLTSAPKSETEKQEPAWRLKITERLKQRLKTSADDMFGIGSQ
KAAVPEARKRKNIRRRHTMGGQRDFADLTVLNTWKDQELENSQKSGVKELELSAMDRLKP
KCPSQDLSITEWLARERLRTSITDLNMDKAAELKPVNTSVNEESKPDLPLSAQEETGSPS
SVTHINRPSPSASPSPHSLDQINGDNHQSKNKSNFSPAVDAHPHKLSGTQVVRSRFYQ
Download sequence
Identical sequences H3A6D8
ENSLACP00000005209 ENSLACP00000005209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]