SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000005394 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSLACP00000005394
Domain Number - Region: 161-220
Classification Level Classification E-value
Superfamily TIMP-like 0.0863
Family Netrin-like domain (NTR/C345C module) 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000005394   Gene: ENSLACG00000004799   Transcript: ENSLACT00000005442
Sequence length 285
Comment pep:known_by_projection scaffold:LatCha1:JH129808.1:139521:194720:1 gene:ENSLACG00000004799 transcript:ENSLACT00000005442 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPPIISYGIAIFLLCKIANSQYSSDQCNWKGSGLTHESHARDVEQVYLRCSEGTLEWLY
PTGALIVNLRPNTLSSSYKRLTVCIKPLRDSRGASIYLEKAGELKLLVSEENRRPNKVYC
YGMDQGALFIEATPKQDISKKITGFQYELRKQRVDTDLHTAPCRPCSDTEVLLAVCTSDF
AVRGSIRSVLHDAELQESTIDASVGRVYRQKSKIFRPIGKSGQWAGQIKAPLECGVKEGE
GDFLFMGSMHFGEARLGCTPWFKDFLRIYKEARDKGQNPCEISTN
Download sequence
Identical sequences H3A6X3
XP_006012443.1.90931 ENSLACP00000005394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]