SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000006870 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000006870
Domain Number 1 Region: 46-106
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000824
Family HLH, helix-loop-helix DNA-binding domain 0.0026
Further Details:      
 
Domain Number 2 Region: 111-163
Classification Level Classification E-value
Superfamily Orange domain-like 0.00000000000000955
Family Hairy Orange domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000006870   Gene: ENSLACG00000006098   Transcript: ENSLACT00000006929
Sequence length 312
Comment pep:known_by_projection scaffold:LatCha1:JH127470.1:201653:214126:1 gene:ENSLACG00000006098 transcript:ENSLACT00000006929 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRPCEETTSDSDMDETIDVGSENNYSGQSNGSLIRSNSPTTTSQIMARKKRRGIIEKRR
RDRINNSLSELRRLVPTAFEKQGSAKLEKAEILQMTVDHLKMLQATGGKGYFDAHALAMD
FMSIGYRECLTEVARYLSSVEGLDTSDPLRVRLVSHLSTYASQREAAVMTSMAHHHHPLH
PHHWTAAFHHLPTALLQQTGLPSSETTLSRLSAMHSSALLTATFAHTDSALRVPSAGSVA
PCVPPLSTSLLSLSATVHAAAAAATAAAQSFPLSFAGAFPMLPPSASSPQQHSSGGANGK
PYRPWGTEVGAF
Download sequence
Identical sequences H3AB49
ENSLACP00000006870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]