SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000007417 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000007417
Domain Number 1 Region: 189-293
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 1.07e-33
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000297
Further Details:      
 
Domain Number 2 Region: 20-123
Classification Level Classification E-value
Superfamily PH domain-like 2.28e-31
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0000524
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000007417   Gene: ENSLACG00000006576   Transcript: ENSLACT00000007478
Sequence length 493
Comment pep:known_by_projection scaffold:LatCha1:JH129219.1:225139:238434:1 gene:ENSLACG00000006576 transcript:ENSLACT00000007478 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNFIWPNLTNLFVFVFFLQTLVTTVVQLYLALPHSSNCWSKQFSGVACFVKDNPKRSYFI
RIYDLKEGKMMWEQELYNQFVYSAPTPYFHTFPSDESQAGLNFTHQEEASDFLNLVEEKI
QKRKQTRHGPAGSSSPTVGMATVNIQNPDITSYRYRGLPTPVAANKKKDKKDKKDKKARL
TKADIGAPSGFKHVSHVGWDPNSGFDLNSMDPDLRNLFNQAGISDAQLVDAETSKVIYDF
IEKQGGLEAVKEEMRKQGPAPPPPPPSRSGGLPPVPQSSAPPPSRGRSGPLPPIPGSSPG
PPPAPSRGPISTPPPPPPSSSPWRGPPPLRGPPPPCPPASRSGGPPPPPPPSSGGGGGPP
PPPPPLPPPAMNSGGPPPPLPPSGNQQAPPPVPSGRGALLDQIRQGMKLNKVSPFDSVFK
PANSLFSFKSSLSAQTSPPHHHHPGWPSPSPGREINNPMAEEGQKKKKKSYHDAIPNEED
DGGDDEEDDEWDD
Download sequence
Identical sequences H3ACP6
ENSLACP00000007417 ENSLACP00000007417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]