SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000007468 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000007468
Domain Number 1 Region: 692-755
Classification Level Classification E-value
Superfamily FF domain 3.4e-16
Family FF domain 0.000038
Further Details:      
 
Domain Number 2 Region: 562-627
Classification Level Classification E-value
Superfamily FF domain 7.06e-16
Family FF domain 0.0000185
Further Details:      
 
Domain Number 3 Region: 797-868
Classification Level Classification E-value
Superfamily FF domain 0.00000000000000628
Family FF domain 0.000012
Further Details:      
 
Domain Number 4 Region: 625-688
Classification Level Classification E-value
Superfamily FF domain 0.00000000000000916
Family FF domain 0.0033
Further Details:      
 
Domain Number 5 Region: 863-920
Classification Level Classification E-value
Superfamily FF domain 0.0000000000392
Family FF domain 0.0043
Further Details:      
 
Domain Number 6 Region: 347-378
Classification Level Classification E-value
Superfamily WW domain 0.000000000653
Family WW domain 0.00035
Further Details:      
 
Domain Number 7 Region: 115-147
Classification Level Classification E-value
Superfamily WW domain 0.00000000935
Family WW domain 0.0016
Further Details:      
 
Domain Number 8 Region: 461-493
Classification Level Classification E-value
Superfamily WW domain 0.0000000699
Family WW domain 0.0036
Further Details:      
 
Weak hits

Sequence:  ENSLACP00000007468
Domain Number - Region: 923-989
Classification Level Classification E-value
Superfamily FF domain 0.0085
Family FF domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000007468   Gene: ENSLACG00000006620   Transcript: ENSLACT00000007530
Sequence length 1007
Comment pep:known_by_projection scaffold:LatCha1:JH126856.1:227447:277353:-1 gene:ENSLACG00000006620 transcript:ENSLACT00000007530 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQQQALRFRGPAPPPNAVMRGPPPLMRPPPPFAMMRGPPPPPRPPFGRPPFDPNMPPMP
PPGGLPPPMGPPHLQRPPFMPPPMGSMPPPPGMMFPPGMPPVAPGAPALPPSEEIWVENK
TLEGKVYYYNARTRESSWTKPDGVKIIQQSELTPVMAPQAQPMSVPATTPTTSSVATSVS
TSATSTTQSSTAPSTTTTTTATTGSQMGSTTSAPDQTPPVTVTSAATQTASASTATVTTT
PVQTVPQPLPQSLPPAVPHAVPQPAAAIPAFPPVMVPPFRVPLPGMPIPLPGVAMMQIVS
CPYVKTVATTKTGVLPGMAPPIVPMIHPQVAIAASPATLTGAAPTPEWTEYKTGDGKTYY
YNNRTLESTWEKPQELKEKVPGPVPVPVPVPVPEKEVEKIKEPSKEVTEEPEPMETEEEE
PKEEPVKEPVKEEPKEEEMTEEEKAAQKAKPVATSPIPGTPWCVVWTGDERVFFYNPTTR
LSMWDKPDELIGRADVDKIIQQPPHKKGTEEEKKPIKEEPESAEETNEDEPVKAKKRKKD
ENKEVDSEKEAAMEAEIKAARERAIVPLEARMKQFKEMLLERGVSAFSTWEKELHKIVFD
PRYLLLNPKERKQVFDQYVKTRAEEERKEKKNKIMQAKEDFKKMMEEAKLNPRTTFSEFA
ARNAKDARFRAIEKMKDREALFSEFIVAVRKKEKEDSKNRGEKVKTEFFELLSEHHLDSQ
SRWSKVKDKIESDSRYKAVESSSMREDLFKQYLEKLAKNLDSDKEKELERQARIEASLRE
REREVQKARSEQTKEIDREREQHKREEAIQNFKALLSDMVRSSDVSWSDTRRTLRKDHRW
ESASLLEREEKEKLFNEHIQALTKKKREHFRQLLDETSAISLTSTWKEVKKVIKEDPRCI
KFSSSDRKKQREFEEYIRDKYVTAKADFRTLLKETKFITYRSKKLTQESDQHLKDIEKIL
LNDKRYLVLECVPEERRKLIMSYVDDLDRRGPPPPPTASEPTRRSTK
Download sequence
Identical sequences H3ACU7
XP_005996147.1.90931 ENSLACP00000007468

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]