SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000007859 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000007859
Domain Number 1 Region: 275-451
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 6.92e-16
Family RNA methyltransferase FtsJ 0.032
Further Details:      
 
Weak hits

Sequence:  ENSLACP00000007859
Domain Number - Region: 757-788
Classification Level Classification E-value
Superfamily WW domain 0.000241
Family WW domain 0.0054
Further Details:      
 
Domain Number - Region: 594-723
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 0.000683
Family mRNA capping enzyme 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000007859   Gene: ENSLACG00000006958   Transcript: ENSLACT00000007925
Sequence length 839
Comment pep:known_by_projection scaffold:LatCha1:JH128986.1:247170:299320:1 gene:ENSLACG00000006958 transcript:ENSLACT00000007925 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRRAEPEISETQKKQRKAIEDLGLNLSSTSDDDTQLSNHATQEKKCFLVGQEGTTCCAS
RDRFNFRECFLQQSYTLHGTLKMRFLCCLTFPAVKAKMGFREGEGLGKFGQGRKEIVEAS
QQRGRRGLGLTLKGFDGELNVSWQDEPQEKSTFPTFTWLFIHCSGVIYNIMRVSVRMCVF
QRKMVIEDETEFCGEDLLHTMLNCKNVFDELEGEEMRRARTRSNPYETIRGVFFLNRAAM
KMANMDFVFDFMFTNPKDSHGKPLVKERDAELLYFADVCAGPGGFSEYVLWRRKWHAKGF
GMTLKGPNDFKLEDFYSAPSELFEPYYGEGGIDGDGDITRPENLTAFRNFVMENTDRKGV
HFLMADGGFSVEGQENLQEILSKQLLLCQFLAGLSLVRTGGHFVCKTFDLFTPFSVGLTY
LLYCCFERISLFKPVTSRPANSERYVVCRGLKCGTEAVRDYLFTINLRLNQLRNSESDVN
EVVPLDVIRGDSEFYEHMIRSNEGYCAHQIKALAKIHAFVRDSTLCEARQADIRKECLKL
WGIPDQARVAPSSVDCKFKFFELIQGTDVDTFSYKPTILNSKILDKIRNVLDYRCMVAAG
EQCFLLGMGRSQIYKWDGRQPVRWEKLDTFKTELPRETLLSVELVQELKGEGRAQRKIFS
IHILDALVLNGTDIREQHFNQRIQLAEKFVKAVSKQSRPDMNPIRVKEVYRLEEMGKIFV
RLEMKITKGSSGMPRLSYTGRDDRHFLPTGLCIIKTVNDPWTMACSKSSKRKFFYNKATG
ESTYELPADSIAPFHICHFERLFWLWEEGVRVHDSQTKQDPEKLSKDDVLAFIQTHYQP
Download sequence
Identical sequences H3ADY8
ENSLACP00000007859 ENSLACP00000007859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]