SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000008934 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000008934
Domain Number 1 Region: 151-425
Classification Level Classification E-value
Superfamily Mitochondrial carrier 7.85e-80
Family Mitochondrial carrier 0.0000363
Further Details:      
 
Domain Number 2 Region: 15-143
Classification Level Classification E-value
Superfamily EF-hand 4e-26
Family Calmodulin-like 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000008934   Gene: ENSLACG00000007890   Transcript: ENSLACT00000009003
Sequence length 434
Comment pep:known_by_projection scaffold:LatCha1:JH128905.1:305934:334213:-1 gene:ENSLACG00000007890 transcript:ENSLACT00000009003 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLIFVSCMDLNSILHLKTKIVKAGDINQDGQLDFDEFSQYLREHEKKLKLAFKSLDKNND
GKVDVSEVMQSLETLGVKLSREHAEKILQSIDADGTMTVDWNEWREHFLFNPATNLQEII
RYWKHSSVLDIGDSITIPDEFTEEEKKTGMWWKQLLSGGVAGAVSRTGTAPLDRLKVLMQ
VHSSKSNKISLGSGFKQMLKEGGVQSLWRGNGTNVLKIAPETALKFLAYEQYKKLLAGEG
GKVRTAERFVAGSLAGATAQTVIYPMEVLKTRLTLRKTGQYSGMFDCAKKVLKVEGIKAF
YKGYVPNILGIIPYAGIDLAIYETLKNAWLQNYAKDSANPGVLVLLGCGTVSSTCGQLAS
YPLALVRTRMQAQASVEGAPQLNMVSLLKKIIEKEGFFGLYRGIAPNFMKVIPAVSISYI
VYEYMKTALGITSK
Download sequence
Identical sequences H3AH13
ENSLACP00000008934 ENSLACP00000008934

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]