SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000009025 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000009025
Domain Number 1 Region: 199-364
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.22e-33
Family Dual specificity phosphatase-like 0.0000214
Further Details:      
 
Domain Number 2 Region: 374-510
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.21e-32
Family PLC-like (P variant) 0.0029
Further Details:      
 
Domain Number 3 Region: 57-189
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000000000573
Family Voltage-gated potassium channels 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000009025   Gene: ENSLACG00000007968   Transcript: ENSLACT00000009094
Sequence length 511
Comment pep:known_by_projection scaffold:LatCha1:JH127414.1:311475:360287:1 gene:ENSLACG00000007968 transcript:ENSLACT00000009094 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSIKYNLESDSEGVNSFRNGEDAKVEIDDGKVEINEPDTWYSTIRKAVAPFVLSFGFRI
FGLVLIIIDIILVIVDLATPEKSIAVRDAIEITSLVISFFFLIDVLLRIFVEGFRVYFQS
KLNILDAVIVIVTLIITMVYAFSDFSGTNLIPRVVNFFRALRIIILIRIFRLASQKKQLE
KATRKMISENKRRYQKDGFDLDLTYVTVTKVQNQFPGSGLETFGRNFLEEVARFLDTKHK
DHYKVYNLCSEKGYDPKYFHYRVERVFIDDHHVPALEDMLKFTASVREWMAEDERNIIAI
HCKGGKGRTGTMICTWLIDSDQFESAKESLDYFGERRTDTSVSSKFQGVETPSQSRYVGY
YEIMKAQNRQLPPEKNLTIKSIRIHSILAGVGRSNGSDLKVQISAKQQVVFQCICATQEN
CKLFFDAESNAAVIRLEGCPVISGDVKVKFESSAGLPKGYDDCPFYFWFNTSFVKNSRLY
LSREELDNPHKPKTWKIYKEKFAVELKFDEP
Download sequence
Identical sequences H3AHA4
ENSLACP00000009025 ENSLACP00000009025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]