SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000009654 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000009654
Domain Number 1 Region: 42-221
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 7.83e-18
Family AlkB-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000009654   Gene: ENSLACG00000008513   Transcript: ENSLACT00000009728
Sequence length 231
Comment pep:known_by_projection scaffold:LatCha1:JH126766.1:348668:355779:1 gene:ENSLACG00000008513 transcript:ENSLACT00000009728 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VDLLQTWLCRTMSPVISPLLILKLKGPFPPNGQLLAGSNSAVLQYLAGSVEVRERFISEE
EEGILLQEIEPTLKRKRYEYDHWDDAIHGYRETEKSQWTERNKAILQRVRDVAFPPGVPQ
LALVHVLDLDKKGYIKPHVDSVKFCGNTIAGLCLLSSSVMRLVSENDACDWVDLLLRRRS
LYILRGRARYEFTHAILREEESVFNGEKVPRNRRISVICRNLPVHESQAVQ
Download sequence
Identical sequences H3AJ33
ENSLACP00000009654 ENSLACP00000009654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]