SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000009842 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000009842
Domain Number 1 Region: 13-122
Classification Level Classification E-value
Superfamily TIMP-like 0.00000000000000785
Family Netrin-like domain (NTR/C345C module) 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000009842   Gene: ENSLACG00000008678   Transcript: ENSLACT00000009918
Sequence length 128
Comment pep:novel scaffold:LatCha1:JH126671.1:362523:363155:-1 gene:ENSLACG00000008678 transcript:ENSLACT00000009918 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NRLKKSHACFPLFCFPLQALKMKIKEVKRENGDRKIVPSKKKKALKLGPIKKKDLKTLVL
YLKNGADCPCHQLENVNSTSTFLIMGRKADSQYLLTGIHKWDKKSKEFKKITKKMKNLKC
PTYQTVFK
Download sequence
Identical sequences H3AJM1
ENSLACP00000009842 ENSLACP00000009842

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]