SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLACP00000012844 from Latimeria chalumnae 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLACP00000012844
Domain Number 1 Region: 394-480
Classification Level Classification E-value
Superfamily BAG domain 5.36e-25
Family BAG domain 0.0000228
Further Details:      
 
Domain Number 2 Region: 14-51
Classification Level Classification E-value
Superfamily WW domain 0.00000000000408
Family WW domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLACP00000012844   Gene: ENSLACG00000011309   Transcript: ENSLACT00000012938
Sequence length 555
Comment pep:known_by_projection scaffold:LatCha1:JH127068.1:592274:611098:-1 gene:ENSLACG00000011309 transcript:ENSLACT00000012938 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SMKTSQPPMVQMASSDPLPPGWEIKIDPQTGWPFFVDHNNRTTTWNDPRLDMLKKKEMQS
SANGPSSASQSLSQDNPPQHQKVQYARYPQLRPGYIPIPVCHEGLEHRCQHPDHFQQPSM
QRVKAEGVTSLPARAQSPSGTPLRDASQTDKQCGLATTAASQGPEKLDMDNNPLVSQRQS
HSQPAPAFQAAPPHQSSRPSMGEPQLPAGYIPIPVIHEGATTRLHPQVHHQLPRTRYPAQ
QNEYSAHHPVFHSLPEEWEQKPGRAHSPFRMAQKDTQSCESSPGRMTSQMRSKSPTRVHI
EKPQIGQQQTHYQDSQPRIQQESKPSFTGMDLPPGYVPIHVSRKEADVKQEPQKSQPKSE
KMDTKIPSPKESVPQKESPEAEQAVPKKPVEPEVSQRHPGLLKVEKILEKVRRLEDEVNT
FEGKKTEKKYLTLEEYLTKELLALDSVDPDGCTDVRQARRDGVRKVQSILERLEQKATDN
METMKVCEPQQNVTEIANQQKNMNIDSVEDINNKETTSDTDKSDTKMEVSTSETKAKVSS
DTLNPTCTLAGTMQP
Download sequence
Identical sequences H3AT73
ENSLACP00000012844

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]